Recombinant Mouse Protein cornichon homolog 2 (Cnih2)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. Please inform us of your tag requirements for preferential development.
The specific tag type is determined during production. Please inform us of your tag requirements for preferential development.
Synonyms
Cnih2; Cnil; Protein cornichon homolog 2; CNIH-2; Cornichon family AMPA receptor auxiliary protein 2; Cornichon-like protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Cnih2
Target Protein Sequence
MAFTFAAFCYMLTLVLCASLIFFVIWHIIAFDELRTDFKNPIDQGNPARARERLKNIERI
CCLLRKLVVPEYSIHGLFCLMFLCAAEWVTLGLNIPLLFYHLWRYFHRPADGSEVMYDAV
SIMNADILNYCQKESWCKLAFYLLSFFYYLYSMVYTLVSF
Uniprot No.
Target Background
Function
Recombinant Mouse Cornichon Homolog 2 (CNIH2) regulates the trafficking and gating properties of AMPA-selective glutamate receptors (AMPARs). It facilitates their membrane and synaptic targeting, modulating gating kinetics (activation, deactivation, desensitization). Furthermore, it inhibits CACNG8-mediated AMPA receptor resensitization.
Gene References Into Functions
- Cornichon-2 and -3 influence subunit-specific AMPA receptor trafficking and synaptic transmission. PMID: 23522044
- Transmembrane AMPAR regulatory proteins and cornichon-2 allosterically modulate AMPAR antagonists and potentiators. PMID: 21343286
- Cornichon homolog 2 (CNIH-2) interacts with TARP γ-8 in hippocampal postsynaptic densities. CNIH-2 levels are reduced in TARP γ-8 knockout mice. PMID: 21172611
Database Links
Protein Families
Cornichon family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Cell junction, synapse, postsynaptic density. Cell projection, dendrite. Cell projection, dendritic spine. Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein.
Tissue Specificity
Brain. Highest levels seen in the hippocampus, intermediate levels in the cerebral cortex, striatum olfactory bulb, and thalamus and lower levels in the cerebellum (at protein level). Also expressed in the lung.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
