Recombinant Mouse Protein cornichon homolog 3 (Cnih3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery timelines.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
Cnih3; Protein cornichon homolog 3; CNIH-3; Cornichon family AMPA receptor auxiliary protein 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Cnih3
Target Protein Sequence
MAFTFAAFCYMLSLVLCAALIFFAIWHIIAFDELRTDFKSPIDQCNPVHARERLRNIERI CFLLRKLVLPEYSIHSLFCIMFLCAQEWLTLGLNVPLLFYHFWRYFHCPADSSELAYDPP VVMNADTLSYCQKEAWCKLAFYLLSFFYYLYCMIYTLVSS
Uniprot No.

Target Background

Function
Cornichon homolog 3 (CNIH3) regulates the trafficking and gating properties of AMPA-selective glutamate receptors (AMPARs). It facilitates AMPAR targeting to the cell membrane and synapses, and modulates gating kinetics by influencing activation, deactivation, and desensitization rates.
Gene References Into Functions
  1. Convergent human and mouse studies support CNIH3's role in opioid dependence pathophysiology, complementing research implicating the AMPA glutamate system. PMID: 26239289
  2. Cornichon-3 and Cornichon-2 knockout mice exhibit significantly reduced AMPA receptor synaptic transmission in the hippocampus. PMID: 23522044
Database Links

KEGG: mmu:72978

UniGene: Mm.338083

Protein Families
Cornichon family
Subcellular Location
Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein.

Q&A

What is Cornichon Homolog-3 (CNIH3) and what is its primary function?

CNIH3 is an AMPA receptor (AMPAR) auxiliary protein that plays two critical roles in glutamatergic neurotransmission. First, it functions as a trafficking protein that facilitates the movement of AMPARs to the postsynaptic membrane. Second, it potentiates AMPAR signaling once the receptors are in place at the synapse . CNIH3 modulates AMPAR activity by altering channel kinetics and enhancing currents through these ionotropic glutamate receptors. This function is particularly important in the hippocampus, a brain region associated with learning and memory formation, where CNIH3 has concentrated expression, especially in the dorsal region . The protein belongs to the evolutionary conserved cornichon family of proteins that were first identified in Drosophila.

How is CNIH3 expression distributed in the mouse brain?

CNIH3 shows a specific pattern of expression in the mouse brain, with studies demonstrating concentrated expression in the dorsal hippocampus . This region is critically associated with spatial learning and memory functions. The expression pattern aligns with the observed behavioral effects when CNIH3 levels are manipulated. To detect and quantify CNIH3 expression, researchers typically use RT-qPCR to measure mRNA levels or immunohistochemistry with specific antibodies to visualize protein localization . When virally overexpressing CNIH3, researchers can also use tags (such as myc-tag) for immunofluorescent visualization to verify injection location and viral spread in targeted brain regions . The specific hippocampal expression pattern suggests CNIH3's specialized role in memory-related neural circuits.

What techniques are used to study CNIH3 function in vivo?

Several methodological approaches have been employed to study CNIH3 function:

  • Genetic knockout models: Researchers have used Cnih3-/- mice from C57BL/6 Cnih3 tm1a(KOMP)Wtsi mice obtained from the Knockout Mouse Project (KOMP) . RT-qPCR verification showed these animals have approximately 60% reduction in exon 4 expression, making them knockdown rather than complete knockout models.

  • Viral overexpression systems: AAV5-CAMKII-myc-CNIH3-t2a-GFP viral constructs have been developed to induce local overexpression of CNIH3 specifically in hippocampal excitatory neurons . This approach allows for:

    • Spatial specificity (targeting the dorsal hippocampus)

    • Cell-type specificity (expression in excitatory neurons via the CAMKII promoter)

    • Visualization of expressing cells (via t2a-GFP tagging)

  • Behavioral testing paradigms: The Barnes maze has been effectively used to measure spatial memory in CNIH3-modified mice, evaluating parameters such as primary errors, primary latency to target, and path efficiency .

  • Molecular assessments: RT-qPCR for quantification of gene expression and immunohistochemistry for protein localization and viral expression confirmation .

What are the sex-specific effects of CNIH3 on spatial memory and how are they experimentally characterized?

CNIH3 demonstrates remarkable sex-specific effects on spatial memory performance, which can be experimentally characterized through several approaches:

Experimental observations of sex differences:

In Barnes maze testing, female Cnih3-/- mice showed significant spatial memory deficits compared to wild-type controls, including:

  • Increased primary errors (more mistakes before finding the target hole)

  • Higher primary latency (longer time to reach the target)

  • Reduced path efficiency (less direct routes to the target)

Methodological approaches to characterize these differences:

  • Controlled behavioral testing: Barnes maze testing with careful counterbalancing of groups and blinded analysis of performance metrics.

  • Statistical validation: Two-way ANOVA analysis to detect main effects of sex and genotype, as well as their interaction . For non-normal datasets, researchers employed nonparametric tests (Kruskal-Wallis and Mann-Whitney) to confirm findings .

  • Estrous cycle monitoring: Recent work has shown that CNIH3's effects may be further dependent on estrous cycle stage in females, adding another layer of complexity to the sex-specific effects .

How does viral-mediated overexpression of CNIH3 in the dorsal hippocampus affect spatial memory performance?

Viral-mediated overexpression of CNIH3 in the dorsal hippocampus produces significant sex-specific effects on spatial memory performance:

Methodological approach:

  • Viral construct design: Researchers developed an AAV5-CAMKII-myc-CNIH3-t2a-GFP viral vector to induce local overexpression of CNIH3 . The construct included:

    • CAMKII promoter for excitatory neuron specificity

    • Myc-tag for protein identification

    • t2a-GFP sequence to visualize expressing cells

  • Surgical delivery: Bilateral stereotaxic injections (0.5 μL per side) targeting the dorsal hippocampus (A/P: −1.8, Lat: ±1.4, D/V: −1.8) .

  • Validation of overexpression: RT-qPCR confirmed approximately 200-fold increase in CNIH3 mRNA expression compared to control (YFP-expressing) animals . Immunofluorescence for the myc-tag confirmed proper targeting and spread of the virus.

Effects on spatial memory performance:

  • Female mice: CNIH3 overexpression resulted in:

    • Significantly fewer primary errors (p = 0.0311)

    • Lower primary latency to target (p = 0.0359)

    • Improved path efficiency (p = 0.0062)

  • Male mice: No significant effects on any spatial memory parameters .

The results demonstrate that supraphysiological levels of CNIH3 in the dorsal hippocampus are sufficient to enhance spatial memory, but only in female mice, further supporting the sex-specific role of this protein in memory processes.

What control conditions should be included when studying CNIH3 in knockout or overexpression models?

When designing experiments to study CNIH3 function using genetic manipulation, several critical controls should be incorporated:

For knockout/knockdown studies:

  • Genotype controls: Include wild-type (+/+), heterozygous (+/-), and homozygous (-/-) animals to assess dose-dependent effects . This allows for examination of whether partial reduction (in heterozygotes) produces intermediate phenotypes.

  • Sex-matched controls: Given the strong sex-specific effects of CNIH3, separate analyses for male and female animals are essential, with appropriate controls for each sex .

  • Molecular validation: Perform RT-qPCR to confirm reduction of target gene expression. The study in the search results showed ~60% reduction of exon 4 in CNIH3 knockdown mice .

  • Homolog expression assessment: Measure expression of functional homologs (e.g., CNIH2) to detect possible compensatory upregulation that might mask phenotypes .

  • Estrous cycle monitoring: For female mice, tracking estrous cycle is important as CNIH3 effects have shown estrous-stage dependence .

For overexpression studies:

  • Control virus: Use of a control virus (e.g., AAV5-CAMKII-eYFP) that lacks the gene of interest but contains the same promoter and fluorescent marker .

  • Expression level verification: Quantify overexpression levels (e.g., the 200× increase in CNIH3 mRNA observed in the referenced study) .

  • Targeting verification: Histological confirmation of viral expression in the targeted brain region using immunofluorescence for tags (e.g., myc-tag) or reporter proteins (e.g., GFP) .

  • Regional specificity: Consider additional controls with virus injections in regions outside the hypothesized area of action.

How should researchers design experiments to account for sex differences in CNIH3 function?

Given the pronounced sex differences in CNIH3 function, careful experimental design is crucial:

What statistical approaches are appropriate for analyzing CNIH3 effects on spatial memory?

Based on the research methodologies described in the search results, several statistical approaches are appropriate when analyzing CNIH3 effects:

  • Two-way ANOVA: To assess main effects of sex and genotype/treatment, as well as their interaction . Specific parameters from the cited research include:

    • For primary errors: sex [F(1, 54) = 12.58, p = 0.0008], genotype [F(2, 54) = 8.539, p = 0.0006], and interaction [F(2, 54) = 12.60, p < 0.0001]

    • For primary latency: sex [F(1, 54) = 16.69, p = 0.0001], genotype [F(2, 54) = 7.549, p = 0.0013], and interaction [F(2, 54) = 15.03, p < 0.0001]

    • For path efficiency: sex [F(1, 54) = 13.85, p = 0.0005], genotype [F(2, 54) = 1.690, p = 0.1941], and interaction [F(2, 54) = 7.870, p = 0.0010]

  • Post-hoc comparisons: When significant main effects or interactions are found, post-hoc tests such as Sidak's multiple comparisons test can identify specific group differences .

  • Nonparametric alternatives: For non-normally distributed data (common in behavioral studies), Kruskal-Wallis and Mann-Whitney tests provide robust alternatives .

  • Repeated measures analysis: For tracking performance across multiple training days or trials, repeated measures ANOVA or mixed-effects models are appropriate.

  • Correlation analysis: To assess relationships between molecular measures (e.g., CNIH3 expression levels) and behavioral outcomes.

Statistical TestApplicationExample from Research
Two-way ANOVAPrimary analysis for factorial designs (sex × genotype)F(1, 54) = 12.58, p = 0.0008 for sex effect on primary errors
Sidak's post-hoc testGroup comparisons following significant ANOVAFemale Cnih3-/- vs WT: p < 0.0001 for primary errors
Kruskal-WallisNon-parametric alternative for comparing >2 groupsFemale mice genotype effect: p = 0.0065
Mann-WhitneyNon-parametric comparison of two groupsFemale CNIH3 overexpression path efficiency: p = 0.0062
Unpaired t-testComparing expression levels between two groupsCNIH3 overexpression: p < 0.0001

How should contradictory findings regarding CNIH3 function be reconciled in research?

When faced with contradictory findings regarding CNIH3 function, researchers should systematically evaluate several factors:

  • Sex differences: Given the strong sex-specific effects of CNIH3, contradictory findings might be due to studying different sexes or failing to analyze sexes separately . Studies showing no effect of CNIH3 manipulation might have pooled data across sexes, masking female-specific effects.

  • Estrous cycle influences: For female animals, the estrous cycle stage significantly impacts CNIH3 function . Contradictory findings might result from testing at different cycle stages or failing to account for this variable.

  • Methodological differences:

    • Knockout efficiency: The referenced study achieved only ~60% reduction in CNIH3 expression (knockdown rather than knockout) . Studies with different levels of knockdown might show different phenotypes.

    • Overexpression levels: The 200-fold increase in CNIH3 mRNA achieved in the viral overexpression study might differ from other overexpression approaches .

    • Regional specificity: Differences in the precise targeting of manipulations within the hippocampus could lead to differing results.

  • Behavioral paradigm sensitivity: Different memory tests (e.g., Barnes maze, Morris water maze, novel object recognition) might have different sensitivity to CNIH3-dependent processes.

  • Mouse strain differences: Genetic background can influence behavioral phenotypes and molecular compensatory mechanisms.

  • Age effects: Developmental timing of CNIH3 manipulation could lead to different outcomes due to critical periods or compensatory adaptations.

To reconcile contradictory findings, researchers should attempt direct replications with careful attention to these variables, collaborate across labs to standardize protocols, and consider multi-site studies to enhance reproducibility.

How does CNIH3 interact with AMPA receptors at the molecular level?

At the molecular level, CNIH3 interacts with AMPA receptors (AMPARs) in several specific ways:

These molecular interactions ultimately contribute to synaptic plasticity mechanisms, including long-term potentiation (LTP) and long-term depression (LTD), which underlie learning and memory processes. The sex-specific effects observed in behavioral studies suggest potential differences in how these molecular interactions are regulated by hormonal or genetic factors between males and females.

What molecular changes occur in the hippocampus following CNIH3 deletion or overexpression?

CNIH3 manipulation leads to several molecular changes in the hippocampus:

Changes following CNIH3 deletion/knockdown:

  • AMPAR localization: Female Cnih3-/- mice show altered biochemical localization of AMPARs in the hippocampus compared to wild-type controls .

  • Synaptic changes: Corresponding changes in synaptic structure and function, but only in female mice and limited to particular phases of the estrous cycle .

  • Transcriptional regulation: CNIH3 deletion dysregulates dorsal hippocampal transcription, suggesting broader effects beyond direct AMPAR interactions .

  • No compensatory upregulation of CNIH2: Despite the functional similarity between CNIH2 and CNIH3, no significant changes in CNIH2 expression were observed following CNIH3 knockdown . This lack of compensation may explain the behavioral deficits observed in female mice.

Changes following CNIH3 overexpression:

  • Maintained specificity: Despite ~200-fold overexpression of CNIH3 mRNA in the dorsal hippocampus, no significant changes in CNIH2 expression were observed, suggesting specificity of the manipulation .

  • Enhanced AMPAR function: While not directly measured in the cited studies, the improved spatial memory performance in female mice suggests enhanced AMPAR-mediated synaptic transmission and plasticity.

The molecular and cellular consequences of CNIH3 manipulation highlight its importance in hippocampal function and provide a mechanistic basis for the observed behavioral effects. The sex-specific nature of these changes points to interactions with sex hormone signaling pathways that remain to be fully characterized.

What are the most promising areas for future research on CNIH3 function?

Based on current findings, several promising research directions emerge:

  • Hormonal interaction mechanisms: Investigating how sex hormones interact with CNIH3 to produce female-specific effects . This could include:

    • Direct effects of estrogen and progesterone on CNIH3 expression or function

    • Hormone-dependent regulation of AMPAR trafficking and signaling

    • Sex-specific transcriptional networks involving CNIH3

  • Circuit-specific functions: Determining if CNIH3 functions differently across various hippocampal subregions (CA1, CA3, dentate gyrus) or in other brain regions where it is expressed.

  • Temporal dynamics of CNIH3 action: Examining how CNIH3's role in AMPAR trafficking and signaling changes during development, learning processes, and aging.

  • Therapeutic potential: Exploring whether CNIH3 modulation could serve as a target for cognitive enhancement or for treating conditions with memory impairments, particularly in females.

  • Molecular partners: Identifying other molecular interactors of CNIH3 beyond AMPARs that might contribute to its function or regulation.

  • Human translational research: Investigating whether human CNIH3 polymorphisms are associated with memory performance or neuropsychiatric conditions, with special attention to sex differences.

  • Computational modeling: Developing computational models of CNIH3-dependent AMPAR kinetics to better understand how molecular interactions translate to cellular and network properties.

What methodological advances would enhance our understanding of CNIH3 function?

Several methodological advances could significantly enhance our understanding of CNIH3 function:

  • Temporally precise manipulation techniques:

    • Optogenetic or chemogenetic control of CNIH3 expression or function

    • Conditional knockout models that allow time-specific deletion of CNIH3

    • Rapid pharmacological modulation of CNIH3-AMPAR interactions

  • Single-cell analysis approaches:

    • Single-cell RNA sequencing to identify cell type-specific expression patterns of CNIH3

    • Patch-clamp electrophysiology combined with CNIH3 manipulation to assess functional effects at the cellular level

    • Super-resolution microscopy to visualize CNIH3-AMPAR interactions at individual synapses

  • In vivo imaging techniques:

    • Two-photon calcium imaging in CNIH3 mutant mice during spatial navigation tasks

    • FRET-based sensors to monitor CNIH3-AMPAR interactions in real-time in living neurons

  • Advanced behavioral analysis:

    • Machine learning algorithms to identify subtle behavioral phenotypes that might be missed by traditional measures

    • Continuous automated home-cage monitoring to assess behavior across the estrous cycle

  • Multi-omics approaches:

    • Integration of transcriptomics, proteomics, and epigenomics data to understand the broader molecular networks involving CNIH3

    • Comparison of these networks between males and females and across the estrous cycle

  • Human neuroimaging studies:

    • Functional MRI studies examining hippocampal activation patterns in individuals with different CNIH3 genetic variants

    • Sex-stratified analyses to determine if findings from mouse models translate to humans

These methodological advances would provide a more comprehensive understanding of CNIH3 function across multiple scales, from molecules to behavior, and could reveal new therapeutic targets for cognitive enhancement or treatment of memory disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.