Recombinant Mouse Protein cornichon homolog 4 (Cnih4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance (additional charges apply).
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please specify your required tag type for preferential development.
Synonyms
Cnih4; Protein cornichon homolog 4; CNIH-4; Cornichon family AMPA receptor auxiliary protein 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-139
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Cnih4
Target Protein Sequence
MEAVVFLFSLLDCCALIFLSVYFIITLSDLECDYINARSCCSKLNKWVIPELVGHTIVTV LMLVSLHWFIFLLNLPVATWNIYRFIMVPSGNMGVFDPTEIHNRGQLKSHMKEAMIKLGF YLLCFFMYLYSMILALIND
Uniprot No.

Target Background

Function
Cornichon homolog 4 (Cnih4) plays a role in the trafficking of G protein-coupled receptors (GPCRs) from the endoplasmic reticulum to the cell surface. It facilitates the exit of GPCRs from the early secretory pathway, likely through interaction with the COPII machinery.
Database Links
Protein Families
Cornichon family
Subcellular Location
Membrane; Multi-pass membrane protein. Endoplasmic reticulum. Endoplasmic reticulum-Golgi intermediate compartment.

Q&A

What is Cornichon homolog 4 (CNIH4) and what are its primary cellular functions?

Cornichon homolog 4 (CNIH4) belongs to the evolutionarily conserved Cornichon protein family that consists of four members in mammals (CNIH1-4). CNIH4 functions primarily as a cargo-sorting receptor that cycles between the endoplasmic reticulum (ER) and the Golgi apparatus . Unlike other Cornichon family members (CNIH1-3), CNIH4 lacks the key residues responsible for binding to AMPA receptors . Its primary established function involves interaction with G-protein coupled receptors (GPCRs), where it controls their exportation from the endoplasmic reticulum . This cargo-sorting function appears to be critical for proper protein trafficking within cells.

For experimental investigation of CNIH4 function, researchers commonly employ genetic knockout models, where a LacZ reporter and polyadenylation site can be inserted after exon 1 to generate Cnih4 knockout alleles (Cnih4 tm1a-/-) . Such models allow assessment of phenotypic consequences of CNIH4 absence in various biological contexts.

How does CNIH4 expression vary across normal and pathological tissues?

CNIH4 exhibits differential expression patterns between normal and pathological tissues, particularly in cancer. Multiple studies have demonstrated that CNIH4 is significantly overexpressed in several cancer types compared to corresponding normal tissues:

  • In head and neck squamous cell carcinoma (HNSC), both mRNA sequencing and protein staining data show significantly higher CNIH4 expression compared to normal tissues

  • In cervical cancer (CESC), CNIH4 expression is considerably elevated in tumor tissues compared to paracancerous cervical tissues

  • In glioma, CNIH4 is overexpressed in malignant variants

What techniques are most effective for studying CNIH4 expression and function?

Researchers employ multiple complementary approaches to study CNIH4:

Expression Analysis:

  • RNA sequencing and qPCR for transcriptional profiling

  • Western blot for protein quantification

  • Immunohistochemistry for tissue localization (CNIH4 antibodies at 1:400 dilution from Invitrogen have been successfully used)

  • Single-cell RNA sequencing for cell-type specific expression patterns

Functional Analysis:

  • siRNA-mediated knockdown to assess loss-of-function effects

  • CRISPR-Cas9 gene editing for generating knockout models

  • Xenograft tumor models in nude mice to evaluate in vivo effects

  • CCK-8 assay to measure cell proliferation

  • Transwell and wound healing assays to assess cell invasion and migration

Computational Approaches:

  • LASSO-Cox regression algorithms for identifying prognostic significance

  • Gene Set Enrichment Analysis (GSEA) for pathway identification

  • Consensus clustering algorithms for molecular subtyping

  • Receiver operating characteristic (ROC) curve analysis for evaluating predictive models

What are the key considerations in establishing and validating CNIH4 knockout models?

When establishing CNIH4 knockout models, researchers should consider:

How does CNIH4 contribute to cancer progression and what are its potential applications as a biomarker?

CNIH4 has been implicated in multiple aspects of cancer progression:

Proliferation and Migration:

  • siRNA-mediated CNIH4 gene knockdown significantly inhibits cellular proliferation, invasion, and migration in cervical cancer cell lines (SiHa and Me180)

  • In xenograft models, CNIH4 knockdown results in significantly lower tumor weights compared to wild-type controls

Cancer Stemness:

  • Enrichment analysis indicates that overactive CNIH4 significantly gathers in stem cell processes

  • Single-cell data analysis shows positive correlation between CNIH4 and stemness markers in head and neck cancer

Prognostic Value:

  • Higher CNIH4 levels are significantly related to poor outcomes in glioma and cervical cancer

  • CNIH4 expression positively correlates with adverse clinicopathological characteristics in multiple cancer types

  • Survival analyses have revealed CNIH4 as an independent risk factor that outperforms traditional prognostic measures in some cancers

Diagnostic Applications:

  • CNIH4-based predictive models have shown potential as auxiliary tools for TNM staging systems

  • In HNSC, CNIH4 expression correlates with clinical parameters including gender and pTNM staging

What mechanisms underlie CNIH4's role in modulating tumor immune microenvironment?

CNIH4 appears to significantly influence the tumor immune microenvironment (TIME):

  • Immune Cell Infiltration: In HNSC, high CNIH4 expression is associated with significantly lower levels of multiple immune cell populations, including:

    • T cell CD4+ central memory

    • Myeloid dendritic cells (both activated and general)

    • Plasmacytoid dendritic cells

    • T cell CD8+

    • B cells (including plasma, memory, and class-switched memory)

    • Monocytes

    • Neutrophils

    • Mast cells

  • Immune Checkpoint Regulation: CNIH4 has been analyzed for correlation with immune checkpoints including CTLA4, LAG3, PDCD1, and TIM3

  • Cytokine Signaling: Gene enrichment analysis of CNIH4-associated genes shows enrichment in "Cytokine-cytokine receptor interaction" pathways

These findings suggest that CNIH4 may play a role in regulating immune cell infiltration and potentially contribute to immune evasion mechanisms in cancer.

What is the functional significance of CNIH4 in male and female gametogenesis?

Despite showing enriched expression in mouse germ cells, genetic knockout studies demonstrate that CNIH4 is not essential for gametogenesis and fertility in mice:

Male Gametogenesis:

  • Cnih4 tm1a-/- male mice exhibit normal fertility

  • Subtle impairments are observed in sperm count, morphology, and motility compared to wild-type mice

  • Testes to body weight ratio and testicular histology remain similar to control mice

Female Gametogenesis:

  • Cnih4 tm1a-/- female mice demonstrate normal fertility

  • Histological examination of Cnih4 tm1a-/- ovaries reveals normal follicles from primordial to antral stages

  • The numbers of follicles at each stage are comparable to wild-type controls

Compensatory Mechanisms:

  • The maintenance of fertility despite CNIH4 knockout is likely due to compensatory upregulation of CNIH3 in the Cnih4 tm1a-/- mice

  • This functional redundancy suggests evolutionary pressure to maintain reproductive capacity

What experimental approaches can distinguish subtle phenotypic effects in CNIH4 knockout reproductive models?

To detect the subtle effects of CNIH4 knockout on reproductive parameters, researchers should consider:

  • Computer-aided sperm analysis (CASA): Provides detailed quantitative assessment of sperm motility parameters beyond manual counting

  • Longitudinal fertility testing: Six-month fertility tests can reveal potential age-related effects that might not be apparent in shorter studies

  • Comparative expression analysis: Assessing expression levels of other Cornichon family members (particularly CNIH3) to identify compensatory mechanisms

  • Detailed histological examination: Quantification of follicles at different developmental stages in female mice

  • Stress conditions: Examining fertility under various stress conditions might reveal phenotypes not apparent under standard conditions

How does CNIH4 interact with specific signaling pathways in cancer progression?

CNIH4's role in cancer progression appears to involve multiple signaling pathways:

Cell Cycle Regulation:

  • Gene enrichment analysis of CNIH4-associated genes shows significant enrichment in "Cell cycle" and "DNA replicate" pathways

  • Single-cell data analysis reveals positive correlation between CNIH4 expression and cell cycle regulatory genes

DNA Repair Pathways:

  • CNIH4 positively correlates with DNA repair mechanisms in single-cell data

  • This may contribute to therapy resistance in certain cancers

GPCR Signaling:

  • As CNIH4 regulates GPCR export from the ER, it may influence downstream GPCR signaling pathways that are important in cancer progression

  • Many GPCRs are known for their essential roles in gonad development and potentially in cancer biology

What approaches can address data contradictions in CNIH4 research?

Researchers studying CNIH4 should be aware of potential contradictions in research findings and consider these approaches to address them:

  • Multi-omics integration: Combining data from genomic, transcriptomic, proteomic, and functional studies provides a more comprehensive understanding and helps resolve contradictions

  • Context-specific analysis: CNIH4 may have different functions in different tissue contexts or cellular states; careful consideration of experimental context is essential

  • Technical validation: Using multiple techniques to validate findings (e.g., confirming RNA-seq results with qPCR, validating protein expression with different antibodies)

  • Genetic compensation assessment: Analyzing expression of related family members (CNIH1-3) to identify potential compensatory mechanisms that might mask phenotypes

  • Single-cell approaches: Bulk tissue analysis may obscure cell type-specific effects; single-cell analysis can reveal heterogeneity in CNIH4 function

What emerging technologies might advance CNIH4 research?

Several cutting-edge approaches could significantly advance our understanding of CNIH4 biology:

  • Spatial transcriptomics: Could reveal tissue-specific expression patterns and co-expression networks involving CNIH4

  • CRISPR screening: Genome-wide CRISPR screens in CNIH4-high versus CNIH4-low backgrounds could identify synthetic lethal interactions and potential therapeutic targets

  • Cryo-EM structural studies: Could elucidate the structural basis of CNIH4's interactions with GPCRs and other cargo proteins

  • Single-cell multi-omics: Integrating single-cell transcriptomics with proteomics or epigenomics could reveal regulatory mechanisms controlling CNIH4 expression

  • Patient-derived organoids: Could provide more physiologically relevant models for studying CNIH4 function in normal and disease states

How might CNIH4 research translate to therapeutic applications?

Potential therapeutic applications based on CNIH4 research include:

  • Biomarker development: CNIH4 expression shows promise as a prognostic biomarker in multiple cancer types

  • Target identification: CNIH4-associated genes identified through bioinformatic analysis could reveal novel therapeutic targets

  • Immunotherapy enhancement: Understanding CNIH4's role in tumor immune microenvironment could inform strategies to enhance immunotherapy response

  • Combination therapy approaches: CNIH4's association with specific cellular processes (cell cycle, DNA repair) suggests potential synergies with existing therapies targeting these pathways

  • Protein trafficking intervention: As CNIH4 functions in protein trafficking, therapeutic strategies disrupting this function could have applications in diseases where aberrant protein transport contributes to pathology

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.