Recombinant Mouse Protein Dos (Dos)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Cbarp; Barp; Dos; R29144/1; Voltage-dependent calcium channel beta subunit-associated regulatory protein; Downstream of Stk11 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-705
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Cbarp
Target Protein Sequence
MATAAATTATVALTTSWDNATSRPTAEPDPILDNYVLLVVVMSLFVGGTLVVLSGVLLLC KRCWEVHQRFNRAMEEAEKTTTTYLDNGTHPIQDWAQFESDSSLFPDPDCRGEDPEGQDT ETERFLATSSTGRRVSFNEAALFEQSRKAQDKGRRYTLTEGDFHHLKNARLTHLHLPPLK IATIHECDSGEASAAATPHPATTSKDSLAIFQPPGKTLTGHSVGPSSALPGGPYNSVDFS EISPSTSSDSGEGISLDAGTRGAKAAGPETVPGEMGTGSSGSGTVLQFFTRLRRHASLDG ASPYFKVKKWKLEPSQRASSLDTRGSPKRHHFQRQRAASESMEQEGDVPHADFIQYIASA GDSVAFPPPRPFLASPTSPPPTLGRLEAAEAAGGASPETPPEHGISLGPEHAQQQDPQQE QDAEHAQCSYRDLWSLRASLELHAATASDHSSSGNDRDSVRSGDSSGSGSGGGGAAPAFP PPPESPPALRPKDGEARRLLQMDSGYASIEGRGAGDEVSELPAPARSPPRSPRAWPRRPR RDYSIDEKTDALFHEFLRHDPHFDDAPRHRTRAHPHTHARKQWQQRGRQHSDPGGARAAT PPGVARPTRAPLRRGDSVDCPPEGRALPITGDDPSIPVIEEEPGGGGGGCPGSGLCVEPA GALLDKLAASLDERLFSPRLAEPVASSQVLIVAAAAPTSPDHSPA
Uniprot No.

Target Background

Function

This protein negatively regulates voltage-gated calcium channels by preventing the interaction between their alpha and beta subunits. This, in turn, negatively regulates calcium channel activity at the plasma membrane and indirectly inhibits calcium-regulated exocytosis.

Database Links
Subcellular Location
Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane; Single-pass type III membrane protein. Cell membrane; Single-pass type III membrane protein. Cell projection, growth cone.
Tissue Specificity
Expressed by neurons in the cortex, cerebellum and hippocampus and by pancreatic beta cells (at protein level).

Q&A

What expression systems are commonly used for recombinant mouse proteins, and how do they affect protein functionality?

Recombinant mouse proteins are typically produced using one of three major expression systems, each with distinct advantages:

E. coli expression system:

  • Advantages: High protein yield, cost-effective, rapid production

  • Limitations: Lacks post-translational modifications, potential endotoxin contamination, improper folding of complex proteins

Pichia pastoris (yeast) expression system:

  • Advantages: Enables proper protein folding and essential post-translational modifications

  • Benefits: Produces bioactive proteins that closely resemble their natural forms

  • Example: Recombinant mouse GM-CSF protein produced in Pichia pastoris has enhanced bioactivity compared to E. coli systems

Mammalian expression systems (e.g., HEK 293):

  • Advantages: Most sophisticated folding and post-translational modifications

  • Example: RISC protein expressed in HEK 293 with >95% purity

The choice of expression system should be determined by the protein's complexity and research requirements. For proteins requiring complex folding or specific glycosylation patterns, the Pichia pastoris or mammalian systems are preferable despite higher production costs.

What are the optimal reconstitution methods for lyophilized mouse recombinant proteins?

Proper reconstitution is critical for maintaining protein bioactivity:

General reconstitution guidelines:

  • Allow protein vial to reach room temperature before opening

  • Quick spin the vial to collect all material at the bottom

  • Reconstitute using appropriate buffer (typically sterile PBS)

  • Include carrier protein when recommended

  • Mix gently by swirling or slow pipetting; avoid vigorous vortexing

Volume considerations:

  • For 10 μg and 50 μg vials: 100 μL is typically appropriate (maximum volume: 500 μL)

  • For 100 μg vials: 1 mL is generally recommended (maximum volume: 2 mL)

Carrier protein requirements:

  • Add at least 0.1% carrier protein (e.g., BSA) to prevent protein adhesion to surfaces

  • For cell assays, culture media may be used if it contains sufficient protein

Special considerations:

  • Some proteins require specific buffers other than PBS

  • Example: Mouse DPP7 protein requires reconstitution at 200 μg/mL in 25 mM Tris and 150 mM NaCl, pH 7.5

How should researchers determine the appropriate concentration of recombinant mouse proteins for various experimental applications?

Determining optimal protein concentration requires careful consideration of several factors:

Bioactivity metrics:

  • ED50 (Effective Dose 50): Concentration at which 50% of maximum response is observed

  • Most manufacturers provide ED50 values for specific bioassays

Application-specific considerations:

  • For cell culture: Start with concentrations near the reported ED50 and test a range

  • For ELISA standards: Follow kit manufacturer recommendations or use 2-fold serial dilutions

  • For Western blot controls: Typically 0.1-1 μg per lane

Experimental planning approach:

  • Review literature for typical concentrations used in similar experiments

  • Consult product datasheets for specific ED50 values (e.g., Mouse Dkk-1 has ED50 of 10-60 ng/mL in Wnt signaling assays )

  • Conduct pilot experiments with concentration gradients

  • Account for species cross-reactivity issues that may affect potency

Important note: As stated in the GenScript FAQ, "GenScript products are used for many different purposes, so it would be impossible to predict every possible application... it is the end user's responsibility to determine the concentrations that work best for their specific assays."

What are the optimal storage conditions for maintaining recombinant mouse protein activity over time?

Proper storage is critical for preserving recombinant protein activity:

Storage recommendations by format:

For lyophilized proteins:

  • Unopened vials: Store at -20°C for up to six months or at -70°C until expiration date

  • Long-term storage: -70°C or colder is recommended for maximum stability

For reconstituted proteins:

  • Short-term (1 week): 2-8°C

  • Medium-term (up to 3 months): -20°C in small working aliquots

  • Long-term: -70°C or colder

Best practices to preserve bioactivity:

  • Prepare small single-use aliquots immediately after reconstitution

  • Add carrier protein (0.2-1% BSA) to reconstituted solutions

  • Minimize freeze-thaw cycles (maximum 4 cycles recommended)

  • Use quick-thawing methods (room temperature water bath) and return to storage promptly

  • Store in non-frost-free freezers to avoid temperature fluctuations

Stability data:
Testing shows properly stored recombinant proteins can withstand room temperature for up to one week without significant activity loss, and approximately four freeze-thaw cycles .

How can researchers confirm the identity and purity of recombinant mouse proteins before experimental use?

Verification of protein identity and purity should be standard practice:

Recommended quality control tests:

Test MethodPurposeExpected Results
SDS-PAGEVerify size and puritySingle major band at expected molecular weight; >95% purity
Western BlotConfirm identityPositive reaction with protein-specific antibody
Mass SpectrometryVerify amino acid sequenceMatch to expected sequence
N-terminal SequencingConfirm correct processingMatch to expected N-terminal sequence
Endotoxin TestingEnsure safety for cell culture<1 EU/μg for most applications

Common purity standards:

  • Research-grade proteins: >95% purity

  • Cell culture grade: >95% purity and <1 EU/μg endotoxin

Identity verification methods:

  • For tagged proteins: Verify tag presence (e.g., His-tag detection)

  • For complex proteins: Verify glycosylation patterns if relevant

  • Example: Mouse Dkk-1 shows multiple bands in SDS-PAGE due to variable glycosylation

What factors should researchers consider when selecting between carrier-free and carrier-containing recombinant mouse proteins?

The choice between carrier-free and carrier-containing formulations depends on the experimental context:

Carrier-free proteins (CF) recommended for:

  • Applications where BSA could interfere with results

  • Antibody generation

  • Mass spectrometry-based studies

  • Certain structural studies

  • Coupling to beads, plates, or surfaces

Carrier-containing proteins preferred for:

  • Cell or tissue culture applications

  • General protein stability enhancement

  • Extended shelf-life requirements

  • Storage at more dilute concentrations

  • Use as ELISA standards

Critical considerations:

  • Carrier-free proteins may require immediate addition of a carrier protein after reconstitution to prevent adsorption to surfaces

  • R&D Systems advises: "In general, we advise purchasing the recombinant protein with BSA for use in cell or tissue culture, or as an ELISA standard. In contrast, the carrier free protein is recommended for applications in which the presence of BSA could interfere."

Example case study:
Recombinant Mouse LIF protein from Qkine (Qk018) is specifically formulated to be both animal-derived component-free and carrier protein-free, making it suitable for highly reproducible results in pluripotent stem cell maintenance .

How does post-translational modification status of recombinant mouse proteins impact their functional properties in research applications?

Post-translational modifications (PTMs) significantly influence protein functionality:

Impact of PTMs on protein function:

  • Glycosylation: Affects protein folding, stability, immunogenicity, and receptor binding

  • Phosphorylation: Critical for signaling pathway activation/deactivation

  • Disulfide bonds: Essential for structural integrity and proper folding

Expression system considerations:

  • E. coli: Lacks machinery for most PTMs, producing proteins without glycosylation

  • Yeast (Pichia pastoris): Provides essential folding and some PTMs, producing proteins that more closely resemble natural forms

  • Mammalian cells: Offer most complete human-like PTM profile

Research application impact:

  • Cell signaling studies: Require properly modified proteins for accurate receptor binding

  • Immunological studies: Glycosylation patterns influence immune recognition

  • Structural studies: PTMs may alter protein conformation

Examples:

  • Mouse LIF produced in yeast maintains pluripotency of mouse embryonic stem cells with higher efficiency than bacteria-derived versions

  • Mouse APRIL protein from Pichia pastoris has proper folding essential for its role in protecting cells from apoptosis

What are the critical considerations for designing bioactivity assays to validate recombinant mouse protein functionality?

Designing effective bioactivity assays requires careful planning:

Key design elements:

ElementConsiderationsExamples
Cell line selectionSpecies compatibility, receptor expressionBalb/3T3 for EGF , FDC-P1 for GM-CSF
Positive controlsBenchmark standards from established sourcesComparison with standard from Supplier A
Response measurementAppropriate readout for protein functionProliferation, signaling, gene expression
Dose rangeInclude ED50 and saturation points3-fold dilutions across 7-8 concentrations
Incubation timeOptimize for maximum signal-to-noise ratio24-72 hours for proliferation assays

Example bioactivity assays:

  • Mouse GM-CSF: Cell proliferation assay using FDC-P1 cell line with ED50 of 0.0015-0.0023 ng/mL

  • Mouse Dkk-1: Inhibition of Wnt-3a-induced reporter activity in HEK293 cells with ED50 of 10-60 ng/mL

  • Mouse Pro-EGF: Cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells with ED50 of 1-5 ng/mL

  • Mouse Reg3B: Stimulation of cell proliferation in RT4-D6P2T rat schwannoma cells with ED50 of 0.2-1 μg/mL

Validation approach:

  • Test multiple protein concentrations to establish dose-response curve

  • Include proper controls (positive, negative, and vehicle)

  • Perform statistical analysis to determine ED50

  • Verify reproducibility across multiple batches

How can researchers effectively address species cross-reactivity issues when working with mouse recombinant proteins?

Species cross-reactivity is a critical consideration in experimental design:

Cross-reactivity considerations:

  • Many human cytokines show activity in mouse cell lines and vice versa

  • Cross-reactivity must be investigated individually for each protein

  • Some proteins may have reduced specific activity when used across species

Experimental approaches to assess cross-reactivity:

  • Direct comparison assays using target cells from different species

  • Receptor binding assays to determine affinity differences

  • Dose-response curves to identify potency differences across species

Examples from literature:

  • Human protein C shows reduced function in mouse plasma, and mouse protein C functions inefficiently in human plasma

  • Modified mouse protein C variants were developed with enhanced membrane affinity and superior anticoagulant properties for mouse models

Practical recommendations:

  • When possible, match protein species to experimental model

  • If cross-species use is necessary, validate activity with pilot experiments

  • Consider increased concentration requirements for cross-species applications

  • Consult literature for known cross-reactivity of specific proteins

What methodologies can researchers employ to accurately quantify the specific activity of recombinant mouse proteins?

Accurate specific activity determination requires standardized methods:

Quantification approaches:

  • ED50 determination:

    • Definition: Protein concentration at which activity is 50% of maximum response

    • Application: For proteins with sigmoidal dose-response curves

    • Method: Plot dose-response curve and calculate concentration at half-maximal effect

  • Conversion to Units/mg:

    • Formula: Specific activity (Units/mg) = 10^6/ED50 (ng/mL)

    • Example: If ED50 = 2 ng/mL, then specific activity = 500,000 Units/mg

Important considerations:

  • Activity measurements are assay-dependent; comparison between different methods is not valid

  • International Units (WHO standards) cannot be directly converted to ED50-based units

  • Specific activity may vary between lots and experiment types, but should fall within established ranges

Best practices:

  • Use the same assay system when comparing different protein lots or sources

  • Include reference standards when possible

  • Report all assay conditions in detail (cell density, passage number, media composition)

  • Validate activity in the specific experimental system being used

What are the optimal immunization protocols for generating antibodies against recombinant mouse proteins?

Designing effective immunization protocols requires careful consideration of multiple factors:

Standard immunization protocol elements:

ParameterRecommendationNotes
Protein amount50-100 μg per immunizationDependent on protein immunogenicity
Adjuvant selectionComplete Freund's for primary; Incomplete for boostersBalance immunogenicity vs. adverse effects
Injection routeSubcutaneous for most applicationsIntraperitoneal alternative for certain studies
Immunization schedulePrimary + boost at 14 daysAdditional boosts may improve response
Sample collection14 days after boostOptimal for IgG response assessment

Example protocol from literature:
A study using recombinant mouse LpxC and GmhA proteins employed:

  • 100 μg protein mixed with Freund's adjuvant (1:2 ratio)

  • Subcutaneous injection route

  • Boost with same dose and incomplete Freund's adjuvant at day 14

  • Serum collection 14 days after immunization for antibody detection

Assessment methods:

  • ELISA to measure antibody titers

  • Western blot to confirm specificity

  • Functional assays to assess neutralizing activity

Additional considerations:

  • Carrier-free proteins preferred for immunization

  • Consider protein modifications that might affect epitope presentation

  • For weakly immunogenic proteins, consider carrier conjugation

  • Always include appropriate controls to verify specificity

How should researchers design experiments to evaluate the effects of recombinant mouse proteins on cell signaling pathways?

Effective experimental design for cell signaling studies requires systematic approach:

Experimental design framework:

  • Pre-experiment considerations:

    • Cell line selection (express relevant receptors)

    • Serum starvation conditions optimization

    • Positive and negative controls identification

    • Time course determination

  • Treatment conditions:

    • Concentration range (include ED50 and 3-5× above/below)

    • Time points (early: 5-30 min; late: 1-24 hours)

    • Inhibitor controls for pathway specificity

  • Readout selection:

    • Western blot for phosphorylation events

    • Reporter assays for transcriptional responses

    • qPCR for gene expression changes

    • Multiplex assays for comprehensive pathway analysis

Example experimental design:
For studying Wnt signaling inhibition by Mouse Dkk-1:

  • Use HEK293 cells with Wnt reporter system

  • Pre-treat with recombinant Mouse Dkk-1 at 10-60 ng/mL

  • Stimulate with Recombinant Mouse Wnt-3a (100 ng/mL)

  • Measure reporter activity

  • Compare to dose-response curve without inhibitor

Critical controls:

  • Vehicle control (buffer with equivalent carrier protein)

  • Pathway-specific positive control

  • Specificity control (non-related stimulus)

  • Inhibitor control to validate pathway specificity

What strategies can researchers employ to optimize recombinant mouse protein delivery in in vivo experimental models?

Optimizing in vivo delivery requires careful consideration of multiple factors:

Delivery route considerations:

RouteAdvantagesLimitationsBest Applications
SubcutaneousSlower release, local effectVariable absorptionLocal immune responses
IntraperitonealRapid systemic distributionPotential irritationChallenge experiments
IntravenousImmediate systemic effectRapid clearanceAcute response studies
Osmotic pumpsContinuous controlled releaseSurgical implantationLong-term studies

Formulation strategies:

  • Carrier protein addition (e.g., BSA) to prevent non-specific binding

  • PEGylation to increase half-life and reduce immunogenicity

  • Encapsulation in liposomes or nanoparticles for controlled release

  • Co-administration with adjuvants for immune response studies

Example from literature:
In a mouse model evaluation of recombinant LpxC and GmhA:

  • 100 μg protein mixed with Freund's adjuvant (1:2 ratio)

  • Subcutaneous injection on the back

  • Boost at 14 days with incomplete Freund's adjuvant

  • Challenge with bacterial strain 14 days after second immunization

Monitoring strategies:

  • Pharmacokinetic sampling to determine half-life

  • Biomarker measurement for functional effect

  • Tissue collection for local concentration determination

  • In vivo imaging for distribution studies (with labeled proteins)

What methodological approaches can researchers use to study protein-protein interactions involving recombinant mouse proteins?

Multiple complementary techniques are available for protein-protein interaction studies:

In vitro interaction methods:

TechniquePrincipleAdvantagesLimitations
Co-immunoprecipitationAntibody-based pulldownDetects native complexesRequires high-quality antibodies
Pull-down assaysTagged protein as baitSimple, versatileMay detect non-physiological interactions
Surface Plasmon Resonance (SPR)Binding kinetics measurementReal-time, quantitativeRequires surface immobilization
ELISA-based bindingPlate-bound detectionHigh-throughputMay miss weak interactions
Size exclusion chromatographyComplex size determinationNative conditionsLimited resolution

Example application:
Mouse protein C variants with enhanced membrane affinity were characterized using:

  • Surface plasmon resonance-based membrane-binding assay

  • Calcium titration experiments to determine binding requirements

  • Functional thrombin generation assay to assess anticoagulant activity

Data analysis considerations:

  • Binding affinity determination (KD, kon, koff)

  • Binding stoichiometry assessment

  • Competition studies to confirm binding site specificity

  • Structural correlation with interaction properties

Advanced techniques:

  • Förster resonance energy transfer (FRET)

  • Bioluminescence resonance energy transfer (BRET)

  • Proximity ligation assay (PLA)

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS)

How can researchers effectively design experiments to assess the immunomodulatory effects of recombinant mouse proteins?

Comprehensive assessment of immunomodulatory effects requires multi-parameter analysis:

Experimental design framework:

  • In vitro immune cell assays:

    • Proliferation assays (T cells, B cells)

    • Cytokine production measurement

    • Differentiation assessment (e.g., Th1/Th2 polarization)

    • Migration/chemotaxis assays

  • Ex vivo analysis:

    • Splenocyte or lymph node cell stimulation

    • Antigen presentation assays

    • Antibody production by isolated B cells

  • In vivo assessment:

    • Immunization protocols with specific readouts

    • Cytokine profiling from serum samples

    • Flow cytometry of immune cell populations

    • Challenge models to assess protection

Example from literature:
A study examining immunomodulatory effects of recombinant LpxC and GmhA proteins:

  • Measured IgG antibody production via serum collection

  • Assessed cytokine production (IL-4, IL-10, IFN-γ) to determine Th1/Th2 balance

  • Found that recombinant GmhA and mixed LpxC/GmhA stimulated both Th1 and Th2 responses

  • Observed that recombinant LpxC alone produced only Th2 responses

Readout selection:

Immune ParameterMeasurement MethodSignificance
Antibody productionELISA, ELISPOTHumoral immunity
T cell activationFlow cytometry (CD69, CD25)Cellular immunity initiation
Cytokine profilesELISA, multiplex bead array, qPCRTh1/Th2/Th17 polarization
Immune cell traffickingFlow cytometry of tissuesCell recruitment
ProtectionChallenge with pathogenFunctional immunity

How can researchers troubleshoot issues with recombinant mouse protein solubility and aggregation?

Addressing solubility and aggregation issues requires systematic troubleshooting:

Common solubility issues and solutions:

IssuePossible CausesSolutions
Insoluble precipitate after reconstitutionImproper reconstitution, denatured proteinUse recommended buffer, add carrier protein, reconstitute slowly
Protein aggregation during storageFreeze-thaw damage, improper bufferAdd stabilizers (e.g., glycerol), aliquot before freezing
Low solubility in working bufferBuffer incompatibility, high concentrationTest different buffers, reduce concentration, add detergent
Visible particles after filtrationProtein aggregates, contaminantsCentrifuge before use, try different reconstitution method

Prevention strategies:

  • Add carrier protein (0.1-1% BSA) to prevent surface adsorption and stabilize protein

  • Optimize reconstitution buffer (pH, salt concentration)

  • Use gentle mixing methods (avoid vortexing)

  • Consider addition of stabilizers (glycerol, trehalose)

Analysis methods:

  • Dynamic light scattering (DLS) to assess aggregation state

  • Size exclusion chromatography to measure monomer/aggregate ratio

  • UV-visible spectroscopy to assess turbidity

  • Centrifugation analysis to separate aggregates

Recovery approaches:

  • Centrifugation to remove large aggregates

  • Filtration through appropriate molecular weight cutoff filters

  • Dilution in fresh buffer with stabilizers

  • Addition of mild detergents (if compatible with downstream applications)

What are the best practices for resolving inconsistent results when using recombinant mouse proteins in biological assays?

Addressing inconsistent results requires systematic investigation:

Common sources of variability:

SourceInvestigation ApproachMitigation Strategy
Protein qualityCheck lot, storage, freeze-thaw cyclesUse single lot, proper storage, fresh aliquots
Cell conditionPassage number, confluence, contaminationStandardize cell culture conditions
Assay componentsReagent quality, preparation methodsCreate standard protocols, validate reagents
Technical executionPipetting errors, timing variationsImprove technique, use automation when possible
Environmental factorsTemperature, CO₂ levels, incubation timeControl environmental parameters

Systematic troubleshooting approach:

  • Validate protein activity with a simple, reliable assay

  • Test multiple concentrations to verify dose-response relationship

  • Include positive controls from reliable sources

  • Assess cell responsiveness with standard stimuli

  • Evaluate timing dependence of the response

Example from literature:
Mouse LIF protein performance was benchmarked against LIF supplement from another supplier (Supplier A) in chemically-defined feeder-free culture, demonstrating that standardized comparison is essential for resolving inconsistencies .

Data analysis considerations:

  • Normalize data to appropriate controls

  • Identify and remove outliers using statistical methods

  • Use replicates to assess variability

  • Consider method-specific sources of error

How should researchers interpret variations in bioactivity between different lots or sources of the same recombinant mouse protein?

Understanding and addressing bioactivity variations requires structured analysis:

Sources of lot-to-lot variation:

  • Expression conditions differences

  • Purification process variations

  • Protein folding efficiency

  • Post-translational modification differences

  • Storage conditions and age of product

Analytical approach:

  • Quantitative comparison:

    • Determine ED50 values for each lot

    • Calculate relative potency ratios

    • Assess dose-response curve shapes

  • Documentation review:

    • Compare certificates of analysis

    • Check lot-specific bioactivity data

    • Review specific activity ranges provided by manufacturer

Manufacturer perspective:
"Specific activity will vary for each lot and for the type of experiment that is done to validate it, but all passed lots will have activity within the established ED50 range for the product and we guarantee that our products will have lot-to-lot consistency. Please conduct an experiment-specific validation to find the optimal ED50 for your system."

Best practices for managing variation:

  • Purchase sufficient quantity of a single lot for complete study

  • Perform side-by-side comparisons when changing lots

  • Establish internal reference standards

  • Adjust concentrations based on relative potency when changing lots

  • Include positive controls in each experiment to normalize results

What approaches can researchers use to distinguish between specific and non-specific effects when using recombinant mouse proteins in complex biological systems?

Distinguishing specific from non-specific effects requires careful experimental design:

Control strategies:

Control TypeImplementationPurpose
Vehicle controlBuffer with carrier proteinControl for buffer effects
Heat-inactivated proteinSame protein denatured by heatControl for non-specific protein effects
Structurally similar proteinRelated protein without target activityControl for general protein class effects
Blocking experimentsCo-administration with neutralizing antibodyVerify specific receptor engagement
Dose-response analysisMultiple concentrationsConfirm biological response scaling
Genetic controlsReceptor knockout cells/animalsValidate receptor dependency

Molecular approaches:

  • Use specific pathway inhibitors to block downstream signaling

  • Employ receptor-specific antagonists to compete for binding

  • Utilize siRNA knockdown of target receptors

  • Apply CRISPR-engineered cell lines lacking specific receptors

Data analysis methods:

  • Statistical comparison to appropriate controls

  • Pathway-specific biomarker correlation

  • Kinetic analysis to distinguish early (likely specific) vs. late (potentially secondary) effects

Example application:
For mouse Wnt signaling studies, Dkk-1 inhibition of Wnt-3a was verified using dose-response curves, demonstrating that the inhibitory effect was concentration-dependent and specific to the Wnt pathway (ED50 10-60 ng/mL) .

How can researchers effectively compare and integrate data from studies using recombinant mouse proteins from different sources or with different formulations?

Effective data integration requires standardized approaches:

Standardization strategies:

  • Activity normalization:

    • Convert to relative activity units

    • Use ED50 ratios to adjust concentrations

    • Perform side-by-side bioassays with reference standards

  • Experimental design considerations:

    • Include internal standards across experiments

    • Maintain consistent readout methods

    • Use the same cell lines and passage numbers

    • Standardize protocols across studies

Meta-analysis approaches:

  • Effect size calculation to standardize across studies

  • Forest plot visualization of standardized results

  • Subgroup analysis based on protein source/formulation

  • Sensitivity analysis to identify source-dependent effects

Practical recommendations:

  • When comparing proteins from different sources, test multiple concentrations to establish equivalence

  • Document and report all relevant protein characteristics:

    • Expression system

    • Formulation details (carrier protein presence/absence)

    • Purity and endotoxin levels

    • Specific activity measurements

  • Consider testing in multiple assay systems to ensure consistency

Example from literature:
"GenScript products are used for many different purposes, so it would be impossible to predict every possible application... The best way to compare the activity of recombinant proteins from different sources is to do the same bioassay side-by-side using the same system."

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.