Recombinant Mouse Protein FAM134A (Fam134a)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for customers.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Retreg2; Fam134a; Reticulophagy regulator 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-541
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Retreg2
Target Protein Sequence
MASSGGGNTGAGGTSGLGLGLGLSLGMGEATGDAEEEAAAAEAVGRLATSLWLRLRGWEA VLAAAQRLLVWEKPLHSLVTAATLNGLFWLLSSSSLRPFFLLSISLLTYFLLDLWHPRFL PDVSAPPPEEPHSDSEGAGSGAQPHLLSVPELCRYLAESWLTFQIHLQELLQYKRQNPAQ FCARGCAACAVLAVLGHYVPGVMISYIVLLSILLWPLVVYHELIQRMYTRLEPLLMQLDY SMKAEADALHHKHDKRKRQGKSAPPAGDEPLAETESESEAELAGFSPVVDVKKTALALAI TDSELSDEEASILESGGFSVSRATTPQLTDVSEDLDQQSLPSEPEEALNRELGEGEETEL ASPEDLLSAPPALSKQALDTEEEGAADKEALLQLSSPLHFVNTHFNGAGSPQDGVKCPPG APVKTLSPEAVSGDLMAPSSTLSPQLCLAESGPVTPLSPSVLPSLPQDSPQPLAAPEEEE ALTTEDFELLDQGELEQLNAELGLGPEMPPKPPDVLPPPPLGADSHSLVQSDQEAHAEVE P
Uniprot No.

Target Background

Database Links
Protein Families
RETREG family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Mainly expressed in the central nervous system and in parenchymatous organs including liver, lung and kidney.

Q&A

What is FAM134A and how does it relate to other FAM134 family members?

FAM134A is one of three paralogues in the FAM134 family (including FAM134B and FAM134C), which function as endoplasmic reticulum (ER)-phagy receptors involved in ER homeostasis and remodeling. All three members share about 30% homology, with the LC3-interacting region (LIR) motif being highly conserved across all family members and species . Despite their shared role in ER-phagy, the FAM134 proteins exhibit tissue-specific expression patterns and are not equally represented in all tissues, suggesting distinct physiological roles for each paralogue .

What domains characterize the structure of FAM134A?

FAM134A contains:

  • A reticulon homology domain (RHD) that forms wedge-shaped membrane inclusions in the ER membrane

  • Two ER-anchoring transmembrane helical hairpins (TM1,2 and TM3,4) that anchor the RHD into the ER membrane

  • A flexible cytoplasmic linker

  • Two amphipathic helices (AH L and AH C) that interact with the cytoplasmic leaflet

  • A highly conserved LIR motif that enables interaction with ATG8 proteins

Molecular dynamics simulations indicate that FAM134A's RHD is more rigid than those of its paralogues, with smaller fluctuations around its average structure, suggesting less flexibility in its conformational states .

How is FAM134A distributed within cells and tissues?

FAM134A shows a broad distribution throughout the ER network, as demonstrated by its overlap with ER markers CALNEXIN (CANX) and REEP5 . At the tissue level, at least one of the FAM134 proteins is found in most analyzed murine organs and tissues, though their levels vary considerably between tissues. This heterogeneous distribution suggests tissue-specific functions for each FAM134 paralogue .

How does FAM134A contribute to ER-phagy?

FAM134A functions as a bona fide ER-phagy receptor through:

  • Binding to mATG8 proteins (including LC3 and GABARAP family members) via its LIR motif

  • Promoting ER fragmentation in a LIR-dependent manner, particularly under stress conditions

  • Facilitating the degradation of ER proteins, especially misfolded proteins like Collagen I

  • Maintaining proper ER morphology and preventing ER expansion

Uniquely among the FAM134 paralogues, FAM134A appears relatively inactive under basal conditions but becomes strongly activated upon cellular stressors like nutrient starvation, as evidenced by increased ER fragmentation when cells are treated with EBSS .

Can FAM134A compensate for the loss of other FAM134 proteins?

Yes, FAM134A demonstrates a unique compensatory ability. In knockout models:

  • Overexpression of either wild-type or ΔLIR mutant FAM134A can rescue pro-Collagen-I accumulation in Fam134b knockout MEFs

  • FAM134A overexpression shows a stronger rescue effect compared to FAM134B in Fam134c knockout cells

  • This suggests FAM134A can function in a parallel, FAM134B-independent pathway

This compensatory mechanism appears to be specific to FAM134A, as FAM134C cannot compensate for the loss of its paralogues .

What is the relationship between FAM134A and LC3/GABARAP proteins?

FAM134A can bind to all six mATG8 proteins (LC3 and GABARAP family members) through its LIR motif, as demonstrated by GST pull-down experiments. Mutation of the LIR motif in FAM134A or mutation of the classical binding site on LC3B abolishes this interaction .

Interestingly, despite this binding capability in vitro, cellular experiments show that FAM134A has a relatively weak interaction with endogenous LC3B but maintains a slight interaction with GABARAP proteins. This suggests potential preferential binding to specific mATG8 family members in vivo .

What are effective methods for studying FAM134A-mediated ER fragmentation?

Recommended methods include:

  • Immunofluorescence microscopy: Expressing HA-tagged FAM134A and co-staining with ER markers (CALNEXIN, REEP5) and autophagy markers (LC3B)

  • ER fragmentation quantification: Counting FAM134A (HA)-positive dots upon overexpression under basal conditions or after treatments like EBSS starvation and Bafilomycin A1

  • ER branching analysis: Calculating changes in ER morphology and comparing with controls

  • Comparison of fragmentation dynamics: Between wild-type and LIR mutant variants using fluorescence microscopy

Research shows that under basal conditions, FAM134A exhibits uniform distribution over the ER network with few LC3B-positive ER fragments, but upon nutrient starvation (EBSS), a strong increase in fragmentation occurs in a LIR-dependent manner .

How can researchers effectively study FAM134A's role in protein degradation?

Effective experimental approaches include:

  • Proteomics analysis: Compare U2OS cells expressing endogenous levels of FAM134 with those overexpressing individual FAM134 proteins under a doxycycline-controlled promoter

  • Principal component analysis (PCA): To reveal clustering patterns and identify proteins significantly altered by FAM134A expression

  • ANOVA testing (FDR < 0.01): To determine significantly altered proteins

  • Heat mapping: To visualize shared clusters of downregulated ER proteins

  • Validation by fluorescent microscopy: For specific targets identified in proteomics data

Studies show that induction of FAM134A leads to mild changes in the global proteome under basal conditions, but the clustering distance from control cells increases upon EBSS treatment, supporting that FAM134A requires a stressor to be fully activated .

What models are most appropriate for studying FAM134A function in vivo?

Based on current research, effective models include:

  • MEF knockout cell lines: Fam134a knockout MEFs show expanded/swollen ER and accumulation of misfolded Collagen I

  • Reconstitution experiments: Reintroducing wild-type or ΔLIR mutant FAM134A into knockout cells

  • Electron microscopy: For detailed analysis of ER morphology changes

  • Immunofluorescence staining: Using ER markers like Climp63 and Canx to confirm phenotypes

  • Overexpression in various knockout backgrounds: To examine compensatory mechanisms between FAM134 paralogues

These models have revealed that Fam134a knockout cells show swollen and dilated ER, indicating a significantly disturbed ER morphology similar to what is observed in Fam134b and Fam134c knockout cells .

How does FAM134A's membrane curvature induction compare with other FAM134 proteins?

Molecular dynamics simulations reveal important differences in membrane curvature induction:

FAM134 ProteinConformational ClustersDominant ClusterMembrane Curvature Induction Rate
FAM134A-RHD3 clusters98.08%176× acceleration factor
FAM134B-RHD11 clusters69.3%, 14.4%, 11.1%235× acceleration factor
FAM134C-RHD10 clusters61.3%, 32.9%206× acceleration factor

What is the significance of FAM134A's LIR-independent function in ER-phagy?

FAM134A demonstrates a unique ability to function in a LIR-independent manner, particularly in compensating for the loss of other FAM134 proteins:

  • Overexpression of FAM134A ΔLIR mutant can rescue pro-Collagen-I accumulation in Fam134b knockout MEFs

  • This suggests FAM134A can utilize alternative mechanisms for targeting misfolded proteins for degradation

  • In contrast to FAM134B, where the LIR motif is essential for its ER-phagy function, FAM134A appears to have evolved additional pathways

This finding has significant implications for understanding the diverse mechanisms of ER-phagy and suggests potential therapeutic targets for conditions where canonical ER-phagy is compromised .

How does stress induction affect FAM134A activity compared to its paralogues?

Stress induction affects the FAM134 paralogues differently:

  • FAM134A: Relatively inactive under basal conditions but strongly activated upon stressors like nutrient starvation

  • FAM134B: Fully active under basal conditions with significant ER fragmentation capacity; shows only modest additional activation upon starvation

  • FAM134C: Shows an intermediate phenotype between FAM134A and FAM134B

Proteomics studies support these observations, showing that FAM134A-induced changes in the global proteome are mild under basal conditions but increase significantly upon EBSS treatment. This suggests different regulatory mechanisms control the activity of each FAM134 paralogue, with FAM134A requiring specific activation signals to fully engage .

How can researchers address contradictory findings when studying FAM134A?

When encountering contradictory data about FAM134A function, consider:

  • Cell-type specific effects: The function of FAM134A may vary between cell types. For example, overexpression of FAM134 proteins in U2OS cells leads to decreased ER protein levels, while knockout in MEFs causes increased levels of the same proteins .

  • Compensatory mechanisms: FAM134A can compensate for loss of other FAM134 proteins, potentially masking phenotypes in single knockout models. Consider using double or triple knockout approaches when possible .

  • Activation state-dependent effects: FAM134A may show different behaviors depending on cellular stress levels. Always compare results under both basal and stressed conditions .

  • LIR-dependent vs. LIR-independent functions: Some FAM134A functions are LIR-dependent while others are not. Using both wild-type and ΔLIR mutants in parallel experiments can help resolve apparent contradictions .

What are the critical controls needed when studying FAM134A-mediated ER-phagy?

Essential controls include:

  • LIR mutant comparisons: Always include FAM134A ΔLIR mutants to differentiate between canonical and non-canonical mechanisms

  • Basal vs. stressed conditions: Compare results under normal conditions and after stressors like EBSS starvation

  • Autophagy inhibition: Include conditions with autophagy inhibitors like Bafilomycin A1

  • Knockout and reconstitution: Use Fam134a knockout cells reconstituted with wild-type or mutant proteins

  • Paralogues comparisons: Include parallel experiments with FAM134B and FAM134C to identify shared and unique functions

These controls are critical as FAM134A shows unique regulatory patterns and compensatory abilities that can complicate data interpretation without proper experimental design .

How should researchers interpret changes in ER morphology when manipulating FAM134A levels?

When analyzing ER morphology changes:

  • ER expansion vs. fragmentation: Fam134a knockout leads to ER expansion with swollen and dilated structures, while overexpression under stress conditions leads to fragmentation. These seemingly opposite phenotypes reflect FAM134A's role in ER homeostasis .

  • ER marker distribution: Use multiple ER markers (e.g., CALNEXIN, REEP5, Climp63) as they may show different patterns depending on ER subdomain alterations .

  • Quantitative measures: Develop consistent quantitative measures for ER alterations, such as measuring ER branch points, ER-positive area, or fragment counts .

  • Time course considerations: FAM134A-mediated changes may have different kinetics than those mediated by FAM134B, with the latter causing more rapid membrane curvature and vesicle formation .

  • Microscopy technique selection: Combining fluorescence microscopy with electron microscopy provides complementary information about ER structure alterations .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.