Recombinant Mouse Protein FAM151A (Fam151a)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If a specific tag is required, please inform us, and we will prioritize its inclusion.
Synonyms
Fam151a; Protein FAM151A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-608
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Fam151a
Target Protein Sequence
MSCKKWCSSSQAKWILAGSVTVTLVLAISLILGLTLHQGTQPGCENDAICGPDADMLDYL MGMGQISHRDGLLVTWYHAANSKKEMAAALNSDVMVLEADVTVEGFNTANETKVPIMAHP PAIYSDNTLQEWLEAVLASSQKGIKLDFKSLKAVGPSLDLLRQLTEAGRIRRPVWINADI LRGPNVPISIEINATQFLTLVQEKYPKATISPGFTTLYVPQLPNSTYTQAMVETMQELVG ALPQKVTFPVRAVMTRAAWPHFSWLLSQSERYSLTLWQGASDPVSVEDLLFIRDNSAAHQ IYYDLFEPVLSQFKQLALNTTRKRTYYTGGSLIPLLQQPKGDGLEVEWLVLEVNGSGRRA AITVPDREGMILLDIGLQEPEAGNPVPILHTPGGPALTLESCLLRLAVHPRRWGIHVNIV EPEALRPSLATLAHLSTLGHLPWPVWVGSTVSHGSFVVPGHIAGRELLTAVAEVFPHVTV APGWPEEMLDSGYQEQMVTDMLELCQGLRQPVSFQLQAGPLSQSPANTVARLLASSPRAT VTVYHSTAGNSHVDLWAGLWAARAVDRTRVYYRISQEYWKDLQADVSSNRPSSRIGPSSV EGFPGESR
Uniprot No.

Target Background

Database Links
Protein Families
FAM151 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is FAM151A and what protein family does it belong to?

FAM151A (Family with sequence similarity 151 member A) is a protein that belongs to the FAM151 family. Sequence analysis indicates that FAM151 proteins are members of the PLC-like phosphodiesterase superfamily, although their specific substrates and enzymatic functions remain largely uncharacterized . The protein contains several conserved domains that suggest potential phosphodiesterase activity, but biochemical confirmation of this function is still pending. The mouse homologue (Fam151a) shares significant sequence similarity with the human protein and is part of a small gene family that includes Fam151b .

What is the molecular structure and key domains of recombinant mouse FAM151A?

Recombinant mouse FAM151A is a 585 amino acid protein with a predicted molecular weight of approximately 66.7 kDa . The protein contains a signal peptide at its N-terminus, suggesting it may be secreted or membrane-associated. When expressed as a recombinant protein, it is typically tagged (e.g., with MYC/DDK tags) to facilitate detection and purification . The amino acid sequence contains several conserved regions that are characteristic of the PLC-like phosphodiesterase superfamily, although the specific catalytic residues and their functional significance remain to be fully elucidated.

How does FAM151A compare to its paralog FAM151B in terms of function?

While FAM151A and FAM151B share sequence similarity, their physiological functions appear distinct. Studies in knockout mouse models have demonstrated that Fam151b homozygous mutants exhibit severe retinal degeneration with no photoreceptor function from eye opening, while Fam151a knockout mice show no discernible phenotype under standard laboratory conditions . This functional divergence suggests that despite their sequence similarity, these paralogs have evolved distinct biological roles, with FAM151B playing a critical role in retinal development or maintenance that cannot be compensated by FAM151A .

What expression systems are optimal for producing recombinant mouse FAM151A?

The optimal expression system for producing recombinant mouse FAM151A depends on the experimental requirements. For structural and functional studies, HEK293T cells have been successfully used to express the full-length protein with C-terminal tags . This mammalian expression system allows for proper folding and potential post-translational modifications. The recombinant protein can be purified using affinity chromatography targeting the C-terminal tags. For research requiring large amounts of protein, stable cell lines may be preferable to transient transfection approaches. Expression protocols typically include:

  • Transfection of HEK293T cells with a vector containing the Fam151a coding sequence

  • Culture for 48-72 hours post-transfection

  • Cell lysis under non-denaturing conditions

  • Affinity purification using tag-specific resins

  • Buffer exchange to remove elution agents

The purified protein should be maintained in a buffer containing 25 mM Tris-HCl, 100 mM glycine, pH 7.3, with 10% glycerol to enhance stability .

What are the recommended storage conditions for maintaining recombinant FAM151A activity?

Based on empirical data for recombinant mouse FAM151A, the following storage conditions are recommended to maintain protein stability and activity:

Storage ParameterRecommendationNotes
Temperature-80°CFor long-term storage
Buffer composition25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerolStabilizes protein structure
AliquotingSmall single-use aliquotsPrevents freeze-thaw damage
Freeze-thaw cyclesAvoid repeated cyclesEach cycle may reduce activity by 10-15%
Working temperatureKeep on ice when thawedMinimizes degradation
Long-term stabilityUp to 12 months at -80°CUnder proper storage conditions

For applications requiring high enzymatic activity, it is essential to minimize freeze-thaw cycles as recombinant proteins can lose activity with each cycle . Additionally, for cell culture applications, sterile filtration is recommended, although this may result in some protein loss .

How can researchers investigate the potential enzymatic activity of FAM151A?

Investigating the potential enzymatic activity of FAM151A requires a systematic approach given its classification in the PLC-like phosphodiesterase superfamily. Researchers should consider:

  • Substrate screening assays: Test various phosphodiester-containing substrates including phospholipids, cyclic nucleotides, and phosphorylated proteins.

  • Active site mutagenesis: Based on sequence alignment with known phosphodiesterases, identify putative catalytic residues and create point mutations to verify their importance.

  • Structural biology approaches: X-ray crystallography or cryo-EM studies of the protein alone and in complex with potential substrates or inhibitors can provide insights into the active site architecture.

  • Activity assays: Employ colorimetric or fluorometric assays that detect phosphodiesterase activity, such as:

    • Para-nitrophenyl phosphate (pNPP) hydrolysis assays

    • Malachite green phosphate detection assays

    • Fluorescence-based assays using specialized substrates

  • Cell-based functional assays: Overexpress FAM151A in appropriate cell lines and monitor changes in relevant signaling pathways potentially affected by phosphodiesterase activity.

These approaches should be complemented with appropriate controls, including catalytically inactive mutants and known phosphodiesterase inhibitors to validate findings.

What are the challenges in resolving contradictory phenotypic data between FAM151A and FAM151B knockout models?

The stark contrast between the absence of phenotype in Fam151a knockout mice and the severe retinal degeneration in Fam151b knockouts presents several research challenges . To address these contradictions, researchers should consider:

  • Compensatory mechanisms: Investigate whether other genes/proteins compensate for FAM151A loss but not FAM151B loss. Techniques such as RNA-seq, proteomics, and phosphoproteomics in wild-type versus knockout tissues can identify compensatory changes.

  • Tissue-specific expression patterns: Perform comprehensive expression profiling of both genes across tissues and developmental stages to identify unique expression patterns that might explain differential phenotypes.

  • Conditional knockout models: Generate tissue-specific and inducible knockout models to bypass potential developmental compensation and examine adult phenotypes.

  • Double knockout approaches: Create Fam151a/Fam151b double knockout models to assess potential redundancy or synergistic effects.

  • Environmental and stress conditions: Challenge Fam151a knockout mice with various stressors (oxidative, metabolic, etc.) to unmask potential phenotypes that are not evident under standard conditions.

  • Molecular function studies: Compare biochemical activities of both proteins to identify functional differences that explain the phenotypic discrepancy.

These approaches can help resolve contradictions and provide insights into the specialized functions of these related proteins in different physiological contexts.

What methods are most effective for identifying FAM151A protein interaction partners?

To comprehensively identify FAM151A protein interaction partners, researchers should employ multiple complementary approaches:

  • Affinity purification-mass spectrometry (AP-MS): Using tagged recombinant FAM151A to pull down interacting proteins from cell lysates followed by mass spectrometry identification. This approach has identified potential interactions with proteins like PLEKHH3 (score 0.466) and CRB2 (score 0.461) .

  • Yeast two-hybrid screening: This technique can identify direct protein-protein interactions but may miss interactions requiring post-translational modifications or membrane context.

  • Proximity labeling approaches: BioID or APEX2 fusions to FAM151A can label proximal proteins in living cells, identifying both stable and transient interactions in the native cellular environment.

  • Co-immunoprecipitation validation: Confirming interactions identified through high-throughput methods using co-IP experiments with antibodies against endogenous proteins.

  • Crosslinking mass spectrometry: Chemical crosslinking followed by mass spectrometry can capture direct protein interactions and provide structural information about the binding interface.

  • Surface plasmon resonance (SPR) or bio-layer interferometry (BLI): These techniques can quantitatively measure binding kinetics between purified FAM151A and candidate interacting proteins.

Based on STRING database analysis, potential interaction partners for further investigation include PLEKHH3, CRB2, and FETUB, with interaction scores of 0.466, 0.461, and 0.422 respectively .

How can researchers validate the functional relevance of predicted FAM151A protein interactions?

Validating the functional relevance of predicted FAM151A interactions requires multiple lines of evidence beyond simple binding assays:

  • Co-localization studies: Fluorescently tagged FAM151A and interacting proteins should be examined by confocal microscopy to verify subcellular co-localization. This is particularly important for interactions with proteins like CRB2, which has specific apical localization in epithelial cells .

  • Functional rescue experiments: In cells depleted of FAM151A, determine whether phenotypes can be rescued by expression of interaction partners or if partners' phenotypes can be rescued by FAM151A.

  • Domain mapping: Identify specific domains of FAM151A responsible for each protein interaction using truncation mutants and point mutations.

  • Competitive binding assays: Determine whether different partners compete for binding to FAM151A or can form multiprotein complexes.

  • Physiological stimulation: Examine whether interactions are constitutive or regulated by specific cellular conditions or signaling events.

  • Mouse genetic interaction studies: Cross Fam151a knockout mice with mice lacking interaction partners to look for genetic interactions (synthetic lethality, suppression, or enhancement of phenotypes).

  • Pathway analysis: Use phosphoproteomics or transcriptomics to determine whether FAM151A and its interaction partners affect the same downstream pathways.

For example, to validate the predicted interaction between FAM151A and CRB2 , researchers should investigate whether FAM151A influences epithelial-to-mesenchymal transition processes where CRB2 plays a known role.

How can researchers address potential annotation errors when studying FAM151A sequence and function?

Annotation errors are a significant concern in genomic research, with studies showing troubling numbers of errors in publicly available genomic data . For FAM151A research specifically, researchers should:

  • Manually verify sequence annotations: Compare sequences across multiple databases (RefSeq, UniProt, Ensembl) to identify discrepancies.

  • Perform phylogenetic analysis: Compare FAM151A sequences across species to identify highly conserved regions that may be functionally important and to detect potential annotation errors.

  • Validate transcript models experimentally: Use RT-PCR and sequencing to confirm gene structure, exon boundaries, and expressed isoforms.

  • Check for truncated sequences: Annotation errors often result in truncated or missing sequences . For FAM151A, ensure that the full protein sequence is being analyzed.

  • Verify ortholog and paralog relationships: Ensure that FAM151A and FAM151B are correctly distinguished in databases and literature.

  • Report errors to databases: When errors are found, submit corrections to the relevant genomic databases to improve community resources.

  • Use multiple independent datasets: Cross-validate findings using independently generated genomic and proteomic data.

As noted in recent research, annotation errors can propagate rapidly as scientists build on previous annotations when sequencing new genomes , making critical evaluation of sequence data essential for reliable FAM151A research.

What considerations are important when designing antibodies for detecting endogenous FAM151A?

Designing effective antibodies for endogenous FAM151A detection requires careful planning:

  • Epitope selection criteria:

    • Choose unique regions not conserved in FAM151B to avoid cross-reactivity

    • Identify surface-exposed regions based on structural predictions

    • Avoid regions with post-translational modifications that might mask epitopes

    • Consider multiple epitopes from different regions of the protein

  • Validation approaches for FAM151A antibodies:

    • Test specificity using wild-type versus Fam151a knockout tissues/cells

    • Perform peptide competition assays

    • Compare results from antibodies targeting different epitopes

    • Validate across multiple applications (Western blot, immunoprecipitation, immunohistochemistry)

  • Species cross-reactivity considerations:

    • Design species-specific antibodies when comparing human and mouse models

    • For cross-species studies, target highly conserved epitopes

  • Expression level challenges:

    • Develop signal amplification strategies for potentially low-abundance protein

    • Consider enrichment approaches (immunoprecipitation) before detection

  • Isoform detection:

    • Design antibodies that can distinguish potential protein isoforms

    • Target regions common to all predicted isoforms for pan-isoform detection

Thorough validation is critical as antibody specificity issues are a major source of irreproducible results in protein research.

What disease models should be investigated to understand the potential pathological significance of FAM151A?

Based on current knowledge about FAM151A and related proteins, several disease models warrant investigation:

  • Retinal disorders: Although Fam151a knockout mice don't show obvious retinal phenotypes, the severe retinal degeneration in Fam151b knockouts suggests potential functional redundancy or compensation. Investigate double knockout models and human retinal disorders with unidentified genetic causes.

  • Neurodevelopmental disorders: The homology to C. elegans menorin gene, which is involved in neuronal branching , suggests potential roles in neurodevelopment. Models of neurodevelopmental disorders, particularly those affecting neuronal morphogenesis, should be examined.

  • Epithelial barrier function disorders: The interaction with CRB2, an apical polarity protein , suggests potential roles in epithelial organization. Models of disorders affecting epithelial barriers (skin, intestine, kidney) might reveal FAM151A functions.

  • Fertility disorders: The interaction with FETUB, which is involved in egg fertilization , suggests potential roles in reproductive processes. Reproductive phenotypes should be carefully assessed in more challenging breeding conditions.

  • Stress response models: Since Fam151a knockout mice show no obvious phenotype under standard conditions , stress models (oxidative stress, metabolic stress, aging) might unmask conditional phenotypes.

  • Cancer models: Dysregulation of phosphodiesterases has been implicated in various cancers. Analyze FAM151A expression and mutation data in cancer databases and consider testing relevant cancer models.

Researchers should prioritize these models based on expression patterns of FAM151A in relevant tissues and correlation with disease markers in human studies.

How can CRISPR-Cas9 genome editing be optimized for functional studies of FAM151A?

CRISPR-Cas9 genome editing offers powerful approaches for FAM151A functional studies, but requires optimization:

  • Guide RNA design considerations:

    • Target exons common to all transcript variants

    • Avoid regions with high homology to FAM151B to prevent off-target effects

    • Design multiple gRNAs targeting different regions

    • Use algorithms that maximize on-target efficiency and minimize off-target effects

  • Knock-in strategy recommendations:

    • For tagging studies, C-terminal tags are preferable as N-terminal tags might disrupt the signal peptide

    • When introducing point mutations, use silent mutations to create restriction sites for screening

    • For domain studies, consider precise deletion of specific domains rather than whole gene knockout

  • Phenotypic analysis approaches:

    • Develop sensitive assays based on predicted phosphodiesterase activity

    • Examine protein localization and trafficking

    • Analyze interactions with predicted partners (PLEKHH3, CRB2, FETUB)

    • Consider high-content imaging and single-cell analysis for subtle phenotypes

  • Verification protocols:

    • Sequence verify all genetic modifications

    • Confirm protein expression changes by Western blot

    • Verify functional changes using enzymatic assays

    • Check for potential compensatory upregulation of FAM151B

  • Cell type selection:

    • Use cell types with endogenous FAM151A expression

    • Consider creating isogenic lines for controlled comparisons

    • For tissue-specific studies, use conditional CRISPR systems

These optimized approaches can help overcome the challenges associated with studying proteins that lack obvious knockout phenotypes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.