Recombinant Mouse Protein FAM162A (Fam162a)

Shipped with Ice Packs
In Stock

Description

Protein Identity

FAM162A is a mitochondrial membrane protein with two transmembrane domains . In mice, it is encoded by the Fam162a gene (UniProt ID: Q9D6U8) and shares 88% sequence identity with human orthologs . Key aliases include E2-induced gene 5 protein (E2IG5), HGTD-P (Human Growth and Transformation-Dependent Protein), and HIF-1 alpha-responsive proapoptotic molecule .

Structure and Localization

  • Transmembrane Domains: Two α-helical transmembrane segments facilitate mitochondrial localization .

  • Localization: Primarily resides in the inner mitochondrial membrane (IMM), particularly within cristae, where it interacts with proteins like OPA1 .

Apoptosis and Hypoxia Response

FAM162A promotes intrinsic apoptosis under hypoxic conditions by:

  • Interacting with hypoxia-inducible factor-1α (HIF-1α) to trigger mitochondrial permeability transition (MPT) .

  • Inducing cytochrome C release, caspase-9/3 activation, and AIFM1 nuclear translocation (in neuronal cells) .

Mitochondrial Dynamics and Bioenergetics

Recent studies reveal FAM162A’s role in maintaining mitochondrial integrity:

  • Ultrastructure: Essential for cristae formation and mitochondrial fusion via OPA1 modulation .

  • Bioenergetics: Silencing FAM162A reduces ATP production and oxidative phosphorylation efficiency .

Cancer and Disease Implications

  • Overexpression in Cancers: Observed in cervical and gastric cancers, where it paradoxically supports cell growth under hypoxia .

  • Neuroprotection: MicroRNA-139-5p agonists reduce FAM162A expression, mitigating hypoxia-ischemia brain damage .

Mouse Models

A chromosomal deletion model (Del 16qB3Δ/16qB3Δ) lacking Fam162a and adjacent genes (Csta, Stfa2l1) showed:

  • Normal Hematopoiesis: No deficits in stem cell activity or tumor susceptibility .

  • Compensatory Gene Expression: Upregulation of phylogenetically related cystatin genes (Stfa1, Stfa2) in hematopoietic tissues .

Drosophila Overexpression

Transgenic Drosophila melanogaster overexpressing human FAM162A exhibited:

  • Enhanced Stress Resistance: Improved survival under heat stress and extended lifespan .

  • Locomotor Activity: Increased mobility linked to mitochondrial health preservation .

Mitochondrial Topology

Protease protection assays confirmed FAM162A’s IMM localization, with the N-terminus in the intermembrane space and C-terminus in the matrix .

Interaction with OPA1

FAM162A depletion reduces OPA1 levels by 50%, impairing mitochondrial fusion and cristae stability .

Paradoxical Role in Cancer

Despite proapoptotic functions, FAM162A overexpression in cervical cancer correlates with enhanced cell proliferation under hypoxia, suggesting context-dependent roles .

Future Directions

FAM162A’s dual role in apoptosis and mitochondrial health positions it as a therapeutic target for:

  • Cancer: Inhibiting FAM162A in hypoxic tumors may suppress survival pathways.

  • Neurodegeneration: Modulating FAM162A/OPA1 interactions could mitigate mitochondrial dysfunction.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
Fam162a; E2ig5; Protein FAM162A; E2-induced gene 5 protein homolog; Growth and transformation-dependent protein; HGTD-P
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-155
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MWSLGGLRLAAGHCLRLYERNASSSLRFTRNTDLKRINGFCTKPQESPKTPTQSYRHGVP LHKPTDFEKKILLWSGRFKKEEEIPETISFEMLDAAKNKLRVKVSYLMIALTVAGCIYMV IEGKKAAKRHESLTSLNLERKARLREEAAMKAKTD
Uniprot No.

Target Background

Function

FAM162A is proposed to regulate apoptosis, although the precise mechanism may vary across cell types and tissues. It may be involved in hypoxia-induced cell death in transformed cells, potentially through cytochrome C release, caspase activation (such as CASP9), and induction of mitochondrial permeability transition. In neuronal cells, FAM162A may contribute to hypoxia-induced cell death by promoting the release of AIFM1 from mitochondria to the cytoplasm and its subsequent nuclear translocation. However, the involvement of caspases in this process remains inconsistently reported.

Database Links
Protein Families
UPF0389 family
Subcellular Location
Mitochondrion membrane; Single-pass membrane protein.

Q&A

What is FAM162A and what is its structural characterization?

FAM162A is an evolutionarily conserved mitochondrial protein expressed across various tissues. The protein contains two transmembrane segments, an extended loop with a short alpha-helix domain, and a C-terminus alpha-helix structure as modeled through AlphaFold 2.0 . Sequence homology analysis shows that FAM162A is highly conserved between different taxa, with protein homology ranging from 99% in monkeys to 50% in fish when compared to humans . This strong evolutionary conservation suggests FAM162A plays a fundamental role in cellular biology. The mouse protein exhibits approximately 88% identity to the human ortholog .

What is the subcellular localization of FAM162A?

FAM162A is predominantly localized to the inner mitochondrial membrane, particularly within the cristae. This localization has been definitively established through protease protection assays in COS7 cells using both fluorescence microscopy and Western blot techniques . The experiments utilized constructs with GFP fused to either the N-terminus (FAM-N-GFP) or C-terminus (FAM-C-GFP) of FAM162A, along with appropriate controls for different mitochondrial compartments. The results clarify previous contradictions regarding FAM162A's precise mitochondrial localization and topology .

How is FAM162A involved in apoptotic regulation?

FAM162A is proposed to be involved in regulation of apoptosis, though the exact mechanism appears to differ between cell types and tissues . In transformed cells, it may participate in hypoxia-induced cell death through cytochrome C release and caspase activation (such as CASP9), and by inducing mitochondrial permeability transition . In neuronal cells, FAM162A likely promotes hypoxia-induced cell death by facilitating the release of AIFM1 from mitochondria to cytoplasm and its translocation to the nucleus, although reports on caspase involvement have been inconsistent .

What methodologies are most effective for studying FAM162A localization and topology?

The protease protection assay has proven effective for determining FAM162A's localization, orientation, and topology. For implementing this methodology:

  • Construct preparation: Generate plasmids expressing FAM162A fused with fluorescent tags (e.g., GFP) or epitope tags (e.g., c-myc) at either the N- or C-terminus.

  • Control selection: Use appropriate compartment markers such as:

    • OMP25_mCherry for outer mitochondrial membrane

    • pmMitoTurquoise for inner mitochondrial membrane/matrix

    • GAPDH for free cytosolic proteins

    • TOM20 for membrane-bound cytosolic proteins

    • SDH2A for mitochondrial matrix

  • Experimental procedure:

    • Transfect cells (e.g., COS7) with the constructs

    • After 24 hours, treat cells sequentially with:

      • 25μg/ml or 400μg/ml Digitonin for 3 minutes

      • 50μg/ml Proteinase K

    • For live confocal microscopy: acquire images pre-digitonin (time 0), post-digitonin (time 180s), and after Proteinase K addition (210s, 240s, 300s)

    • For Western blot: harvest cells after similar treatments and analyze using appropriate antibodies

How does FAM162A influence mitochondrial morphology and dynamics?

FAM162A plays a crucial role in maintaining mitochondrial morphology and fusion dynamics, potentially through its interaction with the fusion protein OPA1. Experimental approaches to investigate this function include:

  • Knockdown studies: Implement siRNA targeting FAM162A to assess its impact on mitochondrial morphology.

  • Morphology classification: Categorize mitochondria into four morphological types (as described by Leonard et al., 2015):

    • Puncta

    • Large and round

    • Rod (with no branches)

    • Network mitochondria (with branches)

  • Quantitative analysis: Measure parameters such as:

    • Mitochondrial area

    • Perimeter

    • Circularity (where 1 represents a perfect circle)

Research findings indicate that FAM162A knockdown results in:

  • Increased puncta mitochondria (from 21% to 34%)

  • Decreased network mitochondria (from 26% to 9%)

  • Significantly smaller and more circular mitochondria

  • Higher proportion of bubble-like swollen mitochondria with broken outer membranes

  • Accumulation of autophagosomes and mitochondria-containing autophagosomes

What techniques can be employed to assess FAM162A's impact on mitochondrial bioenergetics?

To evaluate FAM162A's role in mitochondrial bioenergetics, researchers can employ:

  • Seahorse technology: For measuring oxygen consumption rate (OCR) and extracellular acidification rate (EACR) in cells with FAM162A manipulation (knockdown or overexpression) .

  • MitoTimer experiments: To assess mitochondrial oxidative status:

    • Co-transfect cells with pMitoTimer and either empty vector or FAM162A-OE constructs

    • Treat with pro-oxidants (e.g., 100uM paraquat) if desired

    • Fix cells and visualize using confocal microscopy

    • Analyze the red/green fluorescence ratio as an indicator of mitochondrial oxidative status

  • Transmission Electron Microscopy (TEM): To evaluate ultrastructural changes:

    • Fix cells in 2.5% glutaraldehyde and 0.1 M cacodylate buffer

    • Post-fix with 1% OsO4 and label with 1% uranyl acetate

    • Dehydrate, embed in Epon resin, and section (60-70 nm)

    • Contrast with uranyl acetate and lead citrate

    • Examine with electron microscopy at appropriate voltage (e.g., 80 kV)

How can transgenic models be utilized to study FAM162A function in vivo?

Transgenic Drosophila models offer valuable insights into FAM162A function at the organismal level. The methodology includes:

  • Construct preparation:

    • Clone human FAM162A cDNA (optimized for Drosophila codon usage) into an appropriate vector (e.g., pUASTattB-5xUAS/Mini_Hsp70)

    • Insert the construct into the Drosophila genome

  • Expression system:

    • Employ the UAS/GAL4 system for targeted expression

    • Cross UAS_FAM162A flies with Tubulin-GAL4 flies to generate ubiquitous expression

  • Phenotypic analysis:

    • Lifespan assessment: House 20 flies of each genotype and sex in culture tubes with ad-libitum food at appropriate temperature (e.g., 29°C), monitoring survival daily

    • Stress resistance: Subject flies to heat stress (e.g., 40°C) and record survival and locomotor activity

    • Data analysis: Generate Kaplan-Meier survival curves and assess velocity parameters adjusted by fly weight

Research with this model has revealed that FAM162A overexpression increases lifespan (by approximately 25%) and enhances stress resistance, with more pronounced effects in females than males .

What approaches can resolve the paradox of FAM162A's dual role in apoptosis and cancer?

The paradoxical observation that FAM162A is both pro-apoptotic under hypoxia and overexpressed in cancer suggests complex, context-dependent functions. To investigate this paradox:

  • Comparative expression analysis:

    • Analyze FAM162A expression patterns across normal tissues, hypoxic conditions, and various cancer types

    • Correlate expression levels with clinical outcomes in cancer patients

  • Interaction studies:

    • Identify protein-protein interactions under normoxic versus hypoxic conditions

    • Investigate post-translational modifications that might alter FAM162A function in different contexts

  • Conditional knockdown/overexpression:

    • Develop inducible systems to manipulate FAM162A expression under varying oxygen tensions

    • Assess impact on apoptotic markers, mitochondrial function, and cellular bioenergetics

  • Structural biology approaches:

    • Determine if FAM162A undergoes conformational changes under different conditions

    • Identify functional domains responsible for its distinct roles

Current research suggests that FAM162A's primary role may be in maintaining mitochondrial integrity and bioenergetics through interaction with OPA1, while its pro-apoptotic function becomes dominant under specific stress conditions .

What control experiments are essential when working with recombinant FAM162A?

When using recombinant FAM162A protein in experiments, several control experiments are critical:

  • Antibody validation:

    • Pre-incubate antibodies with the recombinant protein control fragment (e.g., human FAM162A aa 121-152) for 30 minutes at room temperature before use in immunological techniques

    • Use a 100x molar excess of the protein fragment control based on concentration and molecular weight for blocking experiments

  • Cross-reactivity assessment:

    • Test antibody specificity across species, particularly when studying orthologs (mouse FAM162A shows 88% identity to human)

    • Include appropriate positive and negative controls in all experiments

  • Localization controls:

    • When studying subcellular localization, include markers for relevant compartments:

      • Cytosolic markers (e.g., GAPDH)

      • Outer mitochondrial membrane markers (e.g., TOM20)

      • Inner mitochondrial membrane markers

      • Matrix markers (e.g., SDH2A)

How should researchers design experiments to study FAM162A in the context of mitochondrial dynamics?

To properly investigate FAM162A's role in mitochondrial dynamics:

  • Experimental design framework:

    • Implement both loss- and gain-of-function approaches

    • Compare acute (siRNA) versus chronic (stable cell lines) manipulation

    • Analyze effects under both basal and stressed conditions

  • Dynamic assessment methodologies:

    • Live-cell imaging: Use fluorescent proteins targeted to mitochondria to track morphological changes in real-time

    • Fusion assays: Employ photoactivatable GFP or photoconvertible proteins to measure mitochondrial fusion rates

    • Fission analysis: Quantify mitochondrial division events using appropriate markers

  • Protein interaction studies:

    • Investigate FAM162A's relationship with key dynamics proteins:

      • OPA1 (inner membrane fusion)

      • Mitofusins (outer membrane fusion)

      • DRP1 (fission machinery)

The evidence indicates that FAM162A supports mitochondrial fusion through modulation of OPA1, with its knockdown resulting in fragmented mitochondria and altered cristae structure .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.