Recombinant Mouse Protein FAM162B (Fam162b)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder

Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for custom preparation.

Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.

Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested. Advance notice is required for dry ice shipments, and additional charges will apply.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.

Tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.

Synonyms
Fam162b; Protein FAM162B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-157
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Fam162b
Target Protein Sequence
MLWVSRSVLRLGLGFTTHRAPQIISRWPRWGPRVACHPCSSSGQNPSGFEPPEKVHRIPA QYKPSKFDKKILLWTGRFKSIEDIPPLVPPEMIAVSRNKARVKACYIMIGLTIVACFAVI VSAKRAVERHESLTSWNLAKKAKWREEAALAAQSKSK
Uniprot No.

Target Background

Database Links
Protein Families
UPF0389 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is FAM162B and what is its functional significance in mouse development?

FAM162B is a largely uncharacterized protein that has recently gained attention through insertional mutation studies in mice. Research has identified Fam162b as a gene whose expression is regulated in neural crest cells (NCC), particularly those involved in enteric nervous system (ENS) development . The functional significance of FAM162B was revealed through the TashT mouse line, where deregulation of Fam162b expression correlates with defects in enteric neural crest cell migration, leading to partially penetrant aganglionic megacolon phenotypes that resemble human Hirschsprung's disease . The protein appears to play a role in the proper development of the enteric nervous system, though its precise molecular function remains under investigation.

What is known about the expression pattern of Fam162b during mouse development?

In normal mouse development, Fam162b expression appears to be tightly regulated in neural crest cells. The gene is situated in what has been described as a "gene desert" containing multiple highly conserved elements with repressive activity . This suggests that Fam162b expression is normally maintained at controlled levels during development through sophisticated regulatory mechanisms. When these repressive elements are disrupted, as in the TashT mouse line, altered Fam162b expression correlates with developmental abnormalities. Research indicates that Fam162b expression increases following insertional mutations that relieve this repression specifically in neural crest cells, suggesting a tissue-specific regulation pattern crucial for proper enteric nervous system formation .

How is Fam162b genetically regulated and what genomic elements control its expression?

Fam162b is regulated by several conserved genomic elements with repressive activity. The TashT insertional mutation, which disrupts these regulatory elements, results in NCC-specific relief of repression of Fam162b . This regulatory mechanism has been validated through reporter assays and transient transgenesis experiments. The gene is located in a region described as a "gene desert," suggesting complex long-range regulatory control. This regulatory architecture may explain why Fam162b expression is precisely controlled during development, and why disruption of this regulation can lead to developmental abnormalities. Understanding these regulatory mechanisms provides insight into both normal development processes and potential therapeutic approaches for related disorders .

What is the relationship between Fam162b expression and neural crest cell migration?

Research using the TashT mouse model has established that altered Fam162b expression correlates with slower migration of enteric neural crest cells (ENCCs). Detailed analysis of embryonic intestines revealed that the aganglionosis observed in homozygous TashT animals results from impaired ENCC migration . This migration defect ultimately manifests as incomplete colonization of the distal colon by enteric neurons and glia. The relationship appears to involve disruption of critical signaling pathways that guide neural crest cell migration. Specifically, transcriptional profiling of enteric neural crest cells from homozygous TashT embryos shows deregulation of genes encoding members of the GDNF/RET and EDN3/EDNRB signaling pathways, which are essential for ENS formation . These findings suggest that proper regulation of Fam162b is necessary for the coordinated expression of genes involved in neural crest cell migration and ENS development.

How does the TashT insertional mutation affect Fam162b expression and what are the downstream consequences?

The TashT insertional mutation disrupts the repressive regulatory elements controlling Fam162b expression, resulting in NCC-specific relief of repression . This altered expression was confirmed through multiple experimental approaches including RNAseq analyses and chromosome conformation capture (3C) assays. The downstream consequences include:

  • Deregulation of key signaling pathways (GDNF/RET and EDN3/EDNRB) essential for ENS formation

  • Slower migration of enteric neural crest cells during embryonic development

  • Incomplete colonization of the distal colon by enteric neurons and glia

  • Development of aganglionic megacolon with strong male sex bias

Interestingly, the downstream transcriptional changes also include downregulation of specific subsets of X-linked genes, which may contribute to the observed male bias in phenotypic expressivity . This complex cascade of molecular effects highlights how a single regulatory disruption can propagate through developmental networks to cause clinically relevant phenotypes.

What explains the male sex bias in Fam162b-related aganglionic megacolon phenotypes?

The strong male bias in aganglionic megacolon phenotypes observed in the TashT mouse line provides important insights into the unexplained male sex bias seen in human Hirschsprung's disease. Research reveals that while colonic aganglionosis is almost fully penetrant in homozygous TashT animals of both sexes, the megacolon phenotype shows significantly stronger expressivity in males . This sex-based difference can be explained by quantitative variations in enteric nervous system development:

  • Male mice ENS development typically ends around a critical "tipping point" of minimal colonic ganglionosis

  • Female mice ENS development typically progresses just beyond this tipping point

  • This subtle difference in ENS extent becomes clinically significant when functional obstruction occurs

Transcriptional profiling revealed that altered Fam162b expression leads to the downregulation of specific subsets of X-linked genes, potentially explaining this sexual dimorphism . These findings provide a molecular framework for understanding sex biases in developmental disorders and highlight the importance of sex as a biological variable in developmental research.

How does Fam162b relate to other signaling pathways involved in enteric nervous system development?

Transcriptional profiling of enteric neural crest cells from TashT mice reveals that altered Fam162b expression affects multiple signaling pathways crucial for enteric nervous system development. Most significantly, genes encoding components of the GDNF/RET and EDN3/EDNRB signaling pathways show deregulated expression . These pathways are the most important signaling systems for ENS formation and have been implicated in human Hirschsprung's disease. The relationship appears bidirectional:

  • Altered Fam162b expression disrupts these signaling pathways

  • These disrupted pathways further impair neural crest cell migration and differentiation

  • The combined effects manifest as enteric nervous system defects

This interconnected relationship suggests that Fam162b may function as a regulatory node within a larger developmental network. Understanding these interactions is crucial for developing comprehensive models of enteric nervous system development and potential therapeutic interventions for related disorders .

What experimental approaches are recommended for studying Fam162b function in neural crest cells?

Multiple complementary approaches have proven effective for studying Fam162b function in neural crest cells:

Genetic Models:

  • TashT insertional mutation mouse line (partial loss of regulation)

  • CRISPR/Cas9-mediated targeted modifications of Fam162b coding or regulatory regions

  • Conditional expression systems to manipulate Fam162b levels in specific tissues/timepoints

Cell Migration Assays:

  • Ex vivo gut explant cultures to monitor ENCC migration in real-time

  • Time-lapse imaging of fluorescently labeled neural crest cells

  • Boyden chamber or scratch assays using NCC cell lines with modified Fam162b expression

Molecular Characterization:

  • RNAseq for transcriptional profiling of NCCs with altered Fam162b expression

  • Chromosome conformation capture (3C) assays to analyze chromatin interactions at the Fam162b locus

  • Reporter assays to evaluate the activity of Fam162b regulatory elements

These methodologies should be used in combination to provide comprehensive insights into Fam162b function during neural crest cell development and migration .

What protocols are recommended for analyzing Fam162b expression in tissue samples?

For reliable analysis of Fam162b expression in tissue samples, researchers should consider multiple complementary techniques:

RNA-based Methods:

  • Quantitative RT-PCR using validated primers specific to Fam162b

  • RNAscope in situ hybridization for spatial resolution in tissue sections

  • Single-cell RNA sequencing for cell type-specific expression patterns

  • Northern blotting for detecting different transcript isoforms

Protein-based Methods:

  • Immunohistochemistry or immunofluorescence using validated antibodies

  • Western blotting for quantitative protein expression analysis

  • Proximity ligation assays to detect protein-protein interactions

  • Mass spectrometry for protein identification and post-translational modifications

When working with embryonic tissues, developmental staging must be precisely controlled, as Fam162b expression likely changes during development. Additionally, researchers should include both male and female samples in their analyses given the known sex-based differences in phenotypic expression . Appropriate controls should include wild-type tissues, tissues from heterozygous animals, and positive/negative controls for the detection methods used.

How can researchers effectively model Fam162b-related disorders for translational studies?

Effective modeling of Fam162b-related disorders for translational studies requires a multi-level approach:

Animal Models:

  • The TashT mouse line provides a valuable model with high clinical relevance to Hirschsprung's disease

  • Generate additional mouse models with specific Fam162b mutations or expression alterations

  • Consider humanized mouse models expressing human FAM162B variants

Cellular Models:

  • Patient-derived induced pluripotent stem cells (iPSCs) differentiated into neural crest cells

  • Organoid cultures of enteric nervous system development

  • Co-culture systems modeling the interactions between migrating NCCs and gut mesenchyme

Translational Approaches:

  • Compare gene expression profiles between mouse models and patient samples

  • Test therapeutic interventions targeting Fam162b or downstream pathways

  • Develop biomarkers for early detection of related developmental disorders

When designing these models, researchers should pay particular attention to sex as a biological variable, given the strong male bias observed in both the TashT mouse model and human Hirschsprung's disease . Additionally, careful phenotypic characterization should include both morphological and functional assessments, as subtle differences in ENS development can have significant clinical implications.

What considerations should be made when designing experiments with recombinant FAM162B protein?

When working with recombinant FAM162B protein in experimental settings, researchers should consider:

Protein Production and Purification:

  • Expression system selection (bacterial, insect, or mammalian) affects protein folding and post-translational modifications

  • Purification strategy and tag selection impact protein activity and interaction capabilities

  • Protein stability assessment under experimental conditions is essential

  • Quality control testing for endotoxin contamination and aggregation state

Experimental Design:

  • Concentration-response relationships should be established for all applications

  • Appropriate buffer conditions must be determined to maintain protein stability and activity

  • Positive and negative controls should be included in all experiments

  • Time-course studies may be necessary to capture dynamic responses

Functional Assays:

  • Cell-based assays should include assessment of specificity using Fam162b-null cells

  • Migration assays should consider both chemokinetic and chemotactic effects

  • Signaling pathway analysis should examine effects on GDNF/RET and EDN3/EDNRB pathways

  • Protein-protein interaction studies should verify physiologically relevant binding partners

Given the limited characterization of FAM162B to date, researchers should exercise caution in interpreting results and consider multiple complementary approaches to validate findings. Additionally, species differences between mouse and human FAM162B should be considered when extrapolating results to human disease contexts .

What are the key validation steps needed when studying Fam162b in the context of human disease?

When studying Fam162b in the context of human disease, particularly Hirschsprung's disease and related enteric nervous system disorders, several key validation steps are essential:

Genetic Validation:

  • Sequence FAM162B coding and regulatory regions in patient cohorts

  • Perform association studies for identified variants with disease phenotypes

  • Validate functional consequences of variants using reporter assays and expression studies

  • Examine gene-gene interactions with established Hirschsprung's disease genes (RET, EDNRB, etc.)

Functional Validation:

  • Recapitulate patient mutations in cellular and animal models

  • Compare phenotypic characteristics between models and patient presentations

  • Assess effects on neural crest cell migration, proliferation, and differentiation

  • Evaluate impacts on established pathways involved in enteric nervous system development

Translational Validation:

  • Correlate Fam162b-related findings with clinical outcomes in patients

  • Develop and test potential therapeutic approaches targeting relevant pathways

  • Establish biomarkers for disease risk, progression, or treatment response

  • Validate findings across diverse patient populations to account for genetic background effects

This multi-level validation approach is critical given that Fam162b has only recently been identified as a candidate locus for Hirschsprung's disease. The significant male bias observed in both the TashT mouse model and human Hirschsprung's disease provides a particularly compelling avenue for investigation, as understanding the molecular basis of this bias could provide important insights into disease pathogenesis and potential sex-specific therapeutic approaches .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.