Recombinant Mouse Protein FAM176A (Fam176a)

Shipped with Ice Packs
In Stock

Description

Introduction

FAM176A (Family with Sequence Similarity 176, Member A), also known as TMEM166 (Transmembrane Protein 166), is a protein involved in programmed cell death . This protein exhibits broad-spectrum expression across normal human tissues and organs, varying in a cell- and tissue-type-specific manner .

Gene and Protein Structure

The human FAM176A gene encodes a protein that contains 152 amino-acid residues and is well conserved across species .

Expression and Localization

FAM176A expression is found in various human tissues and organs . Decreased FAM176A expression has been observed in several human tumors, including lung cancers .

Role in Programmed Cell Death

FAM176A is involved in the regulation of programmed cell death, facilitating autophagy and apoptosis . Overexpression of FAM176A significantly inhibits the proliferation of tumor cells and induces cell death with both autophagic and apoptotic characteristics .

5.1. Overexpression and Growth Arrest

Adenovirus-mediated expression of FAM176A has demonstrated anti-tumor activity in the H1299 non-small cell lung cancer cell line . Increased FAM176A levels, achieved through recombinant adenovirus vector (Ad5-FAM176A) delivery, inhibit tumor cell growth in a dose- and time-dependent manner .

5.2. Mechanism of Action

FAM176A induces growth arrest via cell autophagy and apoptosis, potentially occurring independently or cooperatively to cause cell death . Additionally, FAM176A induces cell cycle arrest at the G2/M phase, which interferes with DNA damage repair processes, further leading to cell death .

5.3. Therapeutic Potential

Adenovirus-mediated FAM176A gene transfer may represent a novel therapeutic approach for lung cancer treatment .

FAM176A and Cell Cycle Arrest

FAM176A triggers G2/M-phase cell cycle arrest in the H1299 cell line, interfering with DNA damage repair processes and inducing cell death .

FAM176A in Mouse Models

Rodents, including mice, are frequently utilized in preclinical studies to gain initial insights into target structures, with data then extrapolated to humans .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our default shipping includes standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to concentrate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms are stable for 6 months at -20°C/-80°C, while lyophilized forms are stable for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Eva1a; Fam176a; Tmem166; Protein eva-1 homolog A; Protein FAM176A; Transmembrane protein 166
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Eva1a
Target Protein Sequence
MKLPLSPSTEPVATEPLGMALLSSLLAAWSYISENPERAALYFVSGVCIGLFLTLAALVM RISCHTDCRRGPRRRCLQDRECSDSSDSEDGSEDTASDLSVRRHRRFERTLNKNVFTSAE ELERAQRLEERERIIREIWMNGQPEVPGTRSLNRYY
Uniprot No.

Target Background

Function
FAM176A acts as a regulator of programmed cell death, mediating both autophagy and apoptosis.
Gene References Into Functions
  • Eva1a improves cardiac function. PMID: 28151473
  • The EVA1A regulatory network involves ATP synthesis, oxidative phosphorylation, and the TCA cycle. EVA1A plays a crucial role in neuronal differentiation. PMID: 28044434
  • EVA1A deletion impairs NSC self-renewal and differentiation. EVA1A modulates autophagy via the PIK3CA/AKT-mTOR pathway. PMID: 26905199
Database Links
Protein Families
EVA1 family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein. Lysosome membrane; Single-pass membrane protein.

Q&A

What is FAM176A and what are its known functions?

FAM176A (also known as TMEM166) is a novel regulator of programmed cell death that can facilitate both autophagy and apoptosis. It is expressed broadly in most human normal tissues and organs in a cell- and tissue-type–specific manner. Research indicates decreased expression in various human tumors, including gastric cancer, esophagus cancer, adrenal cortical carcinoma, and lung cancers, suggesting a potential tumor suppressive role . In experimental settings, FAM176A overexpression significantly inhibits tumor cell proliferation and induces cell death with both autophagic and apoptotic characteristics .

How is FAM176A expression regulated in normal versus cancerous tissues?

FAM176A shows a broad-spectrum expression pattern in most normal human tissues, with expression varying by cell and tissue type. Notably, decreased FAM176A expression has been documented in various human tumors including gastric cancer, esophagus cancer, adrenal cortical carcinoma, pituitary adenoma, pancreatic islet cell tumor, and parathyroid adenoma . This differential expression pattern suggests that FAM176A may be transcriptionally repressed during oncogenesis, making it a potential biomarker for malignant transformation. Research should focus on identifying the transcriptional regulators and signaling pathways that control FAM176A expression in both normal and cancerous states.

What structural domains characterize FAM176A and how do they relate to its function?

While the search results don't provide complete structural information, FAM176A (TMEM166) is characterized as a transmembrane protein . Researchers studying this protein should consider analyzing its transmembrane domains, potential post-translational modifications, and conserved motifs that might contribute to its dual role in both autophagy and apoptosis. Structural analysis through techniques such as X-ray crystallography or cryo-EM would be valuable to understand how the protein interacts with binding partners in programmed cell death pathways.

What are the optimal methods for producing recombinant mouse FAM176A protein?

Based on the research with human FAM176A, recombinant adenovirus vector systems have been successfully used to express FAM176A . For mouse FAM176A, researchers should consider:

  • Selecting an appropriate expression system (bacterial, insect, or mammalian) based on required post-translational modifications

  • Optimizing codon usage for the expression system

  • Including appropriate purification tags (His, GST, or FLAG) that minimally interfere with protein function

  • Validating protein folding and activity through functional assays

The adenovirus vector system (Ad5) has been specifically demonstrated as effective for FAM176A expression, as shown in research with human non-small cell lung cancer H1299 cells .

How can one assess the functional activity of recombinant FAM176A in experimental models?

To assess recombinant FAM176A functionality, researchers should employ multiple complementary assays:

  • Cell viability assays: MTT, CCK-8, or similar assays to measure growth inhibition in dose- and time-dependent manners

  • Apoptosis assays: Annexin V/PI staining, TUNEL assays, and measurement of caspase activation

  • Autophagy detection: LC3-I to LC3-II conversion, p62/SQSTM1 degradation, and autophagic flux assays

  • Cell cycle analysis: Flow cytometry to assess G2/M phase arrest, which has been observed in FAM176A overexpression models

  • Molecular pathway analysis: Western blotting for key signaling proteins in cell death pathways

Research has shown that adenovirus-mediated FAM176A expression inhibits tumor cell growth in a dose- and time-dependent manner through both autophagy and apoptosis mechanisms .

What experimental design considerations are critical when studying FAM176A in mouse models?

When designing experiments to study FAM176A in mouse models, researchers should consider:

  • Selection of appropriate control groups: Include proper controls as outlined in experimental design literature to ensure validity of results

  • Timing of FAM176A administration/expression: Consider developmental factors, as cancer susceptibility can vary depending on developmental context

  • Tissue-specific expression: Use tissue-specific promoters if targeting expression to specific organs

  • Measurement timing: Plan for both short-term and long-term assessments to capture both immediate effects and compensatory mechanisms

  • Sample size determination: Use power analysis to determine adequate sample sizes for detecting expected effects

Follow principles from experimental design literature to minimize threats to validity and ensure robust, reproducible results .

How does FAM176A contribute to programmed cell death in cancer cells?

FAM176A induces programmed cell death through multiple complementary mechanisms:

  • Apoptosis: FAM176A overexpression activates caspase-dependent apoptotic pathways

  • Autophagy: FAM176A has been shown to induce autophagic characteristics in cancer cells

  • Cell cycle disruption: Research demonstrates that FAM176A can induce cell cycle arrest at the G2/M phase, preventing cancer cell proliferation

These multiple mechanisms may explain why FAM176A shows potent anti-tumor activity across various cancer types. The protein appears to function as a novel regulator that can simultaneously trigger both autophagy and apoptosis, making it an intriguing target for cancer research .

What is the therapeutic potential of FAM176A gene transfer in cancer models?

Adenovirus-mediated FAM176A gene transfer shows promising therapeutic potential in cancer models, particularly for lung cancer. Research has demonstrated that:

  • Ad5-FAM176A can effectively inhibit tumor cell growth in a dose- and time-dependent manner

  • The restored expression of FAM176A leads to strong anti-tumor efficacy through multiple cell death mechanisms

  • The multi-modal action (autophagy, apoptosis, and cell cycle arrest) may help overcome resistance mechanisms that cancer cells develop against single-pathway targeted therapies

These findings suggest that adenovirus-mediated FAM176A gene transfer might represent a novel therapeutic approach for cancer treatment, particularly for lung cancer where FAM176A expression is often decreased .

How does FAM176A expression correlate with different cancer subtypes and prognosis?

While comprehensive correlation data across all cancer subtypes is not provided in the search results, decreased FAM176A expression has been reported in multiple cancer types, including:

  • Gastric cancer

  • Esophagus cancer

  • Adrenal cortical carcinoma

  • Pituitary adenoma

  • Pancreatic islet cell tumor

  • Parathyroid adenoma

  • Lung cancers

This widespread downregulation across various cancers suggests FAM176A may serve as a general tumor suppressor. Researchers should conduct comprehensive analyses of FAM176A expression across cancer databases (such as TCGA) to correlate expression levels with:

  • Cancer subtypes

  • Histological grades

  • Patient survival

  • Treatment responses

Such analyses would help determine the prognostic value of FAM176A and identify cancer types most likely to benefit from FAM176A-based interventions.

What signaling pathways interact with FAM176A in mediating its anti-tumor effects?

The search results don't provide complete information on all signaling pathways interacting with FAM176A, but they indicate involvement in:

  • Apoptotic pathways involving caspase activation

  • Autophagic pathways

  • Cell cycle regulatory mechanisms, particularly at the G2/M checkpoint

Advanced research should focus on mapping the complete signaling network of FAM176A, including:

  • Identifying direct binding partners through techniques like co-immunoprecipitation and mass spectrometry

  • Characterizing upstream regulators that control FAM176A expression

  • Elucidating downstream effectors that execute its anti-tumor functions

  • Investigating potential crosstalk with other cancer-related pathways such as PI3K/mTOR, which may be relevant based on some indications from NR2F1-related studies

How does FAM176A compare functionally to other known tumor suppressors?

To compare FAM176A with other tumor suppressors, researchers should conduct comparative studies examining:

  • Expression patterns across normal and cancerous tissues

  • Mechanisms of action (direct vs. indirect effects on cell proliferation and death)

  • Genetic alterations (mutations, deletions, epigenetic silencing) in cancer

  • Restoration effects in cancer models

FAM176A appears unique in its ability to simultaneously regulate both apoptosis and autophagy , suggesting it may function at a key decision point between different cell death pathways. This dual functionality distinguishes it from tumor suppressors that primarily affect one pathway, potentially making it a more robust anti-cancer agent less susceptible to resistance mechanisms.

What are the potential off-target effects or toxicities associated with FAM176A overexpression?

The search results don't directly address off-target effects or toxicities of FAM176A overexpression. Since FAM176A is normally expressed in various human tissues , researchers should investigate:

  • Effects of FAM176A overexpression on normal, non-transformed cells

  • Tissue-specific responses to increased FAM176A levels

  • Potential immunogenic responses to recombinant FAM176A

  • Long-term consequences of sustained FAM176A overexpression

Understanding these potential side effects is crucial for developing FAM176A as a therapeutic approach. Researchers should design experiments that include appropriate normal cell controls and conduct comprehensive toxicity assessments in both in vitro and in vivo models.

How should researchers address contradictory findings regarding FAM176A function?

When faced with contradictory findings regarding FAM176A function, researchers should:

  • Carefully examine experimental conditions that might explain differences:

    • Cell types used (cancer vs. normal, tissue origin)

    • Expression levels achieved (physiological vs. supraphysiological)

    • Timing of observations (immediate vs. delayed effects)

  • Consider context-dependent functions:

    • Microenvironment influences

    • Genetic background differences

    • Pre-existing activation of other pathways

  • Use multiple complementary techniques to assess each endpoint

    • Combine different apoptosis assays

    • Verify autophagy through multiple markers

    • Assess cell cycle effects with both flow cytometry and molecular markers

  • Apply rigorous experimental design principles as outlined in Campbell and Stanley's work to minimize threats to validity

What statistical approaches are most appropriate for analyzing FAM176A expression data in complex datasets?

For analyzing FAM176A expression data in complex datasets, researchers should consider:

  • For differential expression analysis:

    • Use appropriate normalization techniques for the specific platform

    • Apply multiple testing correction (e.g., Benjamini-Hochberg FDR)

    • Utilize both parametric and non-parametric tests when distribution assumptions may be violated

  • For correlation studies:

    • Examine correlations between FAM176A and related genes

    • Consider gene set enrichment analysis (GSEA) to identify pathways co-regulated with FAM176A

    • Use principal component analysis to identify patterns in high-dimensional data

  • For survival analysis:

    • Apply Kaplan-Meier with log-rank tests for univariate analysis

    • Use Cox proportional hazards models for multivariate analysis, including relevant clinical covariates

  • For experimental data:

    • Follow design principles that allow for testing interaction effects, particularly in factorial designs

    • Consider time-series analysis approaches for tracking expression changes over time

How can researchers integrate FAM176A functional data with broader -omics datasets?

To integrate FAM176A functional data with broader -omics datasets, researchers should:

  • Correlate FAM176A expression with:

    • Transcriptomic profiles to identify co-regulated genes

    • Proteomic data to identify potential interaction partners

    • Epigenomic data to understand regulatory mechanisms

  • Use network analysis approaches to:

    • Place FAM176A within functional protein networks

    • Identify potential master regulators controlling FAM176A expression

    • Map FAM176A to known cancer-related pathways

  • Apply pathway enrichment analysis to:

    • Identify biological processes associated with FAM176A expression

    • Compare FAM176A-induced changes to known drug response signatures

    • Discover potential synthetic lethal interactions

This integration approach was partially demonstrated in research that identified anti-correlation between FAM176A-related factors and genes involved in cell cycle, proliferation, and DNA-damage response .

What are the most promising avenues for translating FAM176A research into clinical applications?

Based on current understanding of FAM176A function, the most promising translational directions include:

  • Gene therapy approaches:

    • Adenoviral vectors for FAM176A delivery have shown promising anti-tumor effects in preclinical models

    • Development of targeted delivery systems to enhance tumor specificity

    • Combination with existing therapies to enhance efficacy

  • Small molecule drug development:

    • Screening for compounds that can upregulate endogenous FAM176A expression

    • Identifying molecules that mimic FAM176A's dual autophagy/apoptosis induction

    • Developing drugs targeting downstream effectors in the FAM176A pathway

  • Biomarker applications:

    • Validation of FAM176A expression as a prognostic or predictive biomarker

    • Development of companion diagnostics to identify patients most likely to benefit from FAM176A-based therapies

  • Combination therapies:

    • Investigating synergies between FAM176A restoration and conventional chemotherapies

    • Testing FAM176A with targeted therapies such as PI3K/mTOR inhibitors, which might have connections to FAM176A pathways

What are the key unanswered questions about FAM176A biology that require further investigation?

Critical unanswered questions about FAM176A biology include:

  • Structural basis of function:

    • What domains/motifs are responsible for autophagy vs. apoptosis induction?

    • How does the protein interact with the cell death machinery?

  • Regulatory mechanisms:

    • What controls FAM176A expression in normal and cancer cells?

    • What post-translational modifications affect FAM176A activity?

  • Evolutionary aspects:

    • How conserved is FAM176A function across species?

    • Do functional differences exist between mouse and human FAM176A?

  • Cell type specificity:

    • Why does FAM176A expression vary across cell types?

    • Are there tissue-specific co-factors that modify FAM176A function?

  • Resistance mechanisms:

    • How do cancer cells downregulate or inactivate FAM176A?

    • What mechanisms might lead to resistance to FAM176A-based therapies?

Addressing these questions will significantly advance understanding of FAM176A biology and facilitate its development as a therapeutic target.

What novel methodologies might advance our understanding of FAM176A function?

To further advance understanding of FAM176A function, researchers should consider these innovative approaches:

  • Advanced imaging techniques:

    • Live-cell imaging to track FAM176A localization during cell death processes

    • Super-resolution microscopy to visualize interactions with organelles and other proteins

  • CRISPR-based approaches:

    • CRISPRa/CRISPRi for precise modulation of endogenous FAM176A expression

    • CRISPR screens to identify synthetic lethal interactions

    • Base editing to introduce specific mutations for structure-function studies

  • Single-cell technologies:

    • Single-cell RNA-seq to capture heterogeneity in FAM176A expression and responses

    • Single-cell proteomics to analyze protein interaction networks at the individual cell level

  • Organoid and patient-derived xenograft models:

    • Testing FAM176A function in more physiologically relevant 3D systems

    • Evaluating effects across diverse genetic backgrounds

  • Computational approaches:

    • AI-based prediction of FAM176A interactors and functional domains

    • Systems biology modeling of FAM176A in cell death decision networks

These advanced methodologies would complement existing approaches and provide deeper insights into the complex biology of FAM176A.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.