Recombinant Mouse Protein FAM176B (Fam176b)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Eva1b; Fam176b; Protein eva-1 homolog B; Protein FAM176B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-164
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Eva1b
Target Protein Sequence
MDAPRRDMELLSNSLAAYAHIRANPESFGLYFVLGVCFGLLLTLCLLVISISCAPRSRPR TPAPRRDPRSSTLEPEDEDDEEDEDTMTRLGPDDTLQGQELSTEPDGPLSVNVFTSAEEL ERAQRLEERERILREIWRTGQPDLLGSGTLGPGATATLGRMHYY
Uniprot No.

Target Background

Database Links

KEGG: mmu:230752

UniGene: Mm.41569

Protein Families
EVA1 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Recombinant Mouse Protein FAM176B?

Recombinant Mouse Protein FAM176B (Fam176b) is a full-length protein corresponding to amino acids 1-164 of the native mouse Fam176b protein (Q8K2Y3). It is typically produced with an N-terminal His tag and expressed in E. coli expression systems to enable laboratory research applications . This recombinant version allows researchers to study the protein's functions in controlled experimental settings where the native protein might be difficult to isolate in sufficient quantities or purity.

What are the structural characteristics of Recombinant Mouse FAM176B?

Recombinant Mouse FAM176B is a relatively small protein consisting of 164 amino acids with the addition of an N-terminal histidine tag for purification purposes. The protein's molecular structure features characteristic domains that mediate its biological functions, though specific structural details are still being investigated by researchers. When expressed in E. coli, the protein maintains its primary sequence integrity while potentially lacking some post-translational modifications present in mammalian-expressed versions .

How does Recombinant Mouse FAM176B differ from other recombinant mouse proteins?

Unlike other recombinant mouse proteins such as B7-H2 (which is involved in T cell co-stimulation) or Fibulin-7 (which interacts with extracellular molecules like Fibronectin) , FAM176B has distinct biological functions. While proteins like BAFF are expressed in yeast systems to ensure proper folding and post-translational modifications , FAM176B is typically expressed in bacterial systems, which can impact its structural characteristics and experimental applications compared to these other proteins.

What expression systems are optimal for producing Recombinant Mouse FAM176B?

Expression SystemAdvantagesLimitationsBest Used For
E. coliHigh yield, cost-effective, rapid productionLimited post-translational modifications, potential improper foldingStructural studies, antibody production
Pichia pastorisBetter protein folding, some post-translational modificationsLower yield than E. coli, longer production timeFunctional assays requiring proper folding
Mammalian cellsNative-like post-translational modifications, proper foldingExpensive, low yield, complex protocolsSignaling studies, in vivo applications

The choice of expression system should align with specific experimental requirements and the intended applications of the protein.

What purification strategies yield the highest purity for Recombinant Mouse FAM176B?

For His-tagged Recombinant Mouse FAM176B, immobilized metal affinity chromatography (IMAC) represents the primary purification method . For optimal purity, researchers should implement a multi-step purification strategy:

  • Initial capture using Ni-NTA or cobalt-based resins exploiting the His-tag affinity

  • Secondary purification using size exclusion chromatography to separate monomeric protein from aggregates

  • Optional ion exchange chromatography step if higher purity is required

  • Quality control assessment using SDS-PAGE and Western blotting to confirm purity and integrity

This approach typically yields protein with >95% purity suitable for most research applications.

What are the optimal storage conditions for maintaining Recombinant Mouse FAM176B activity?

Based on protocols for similar recombinant proteins, Recombinant Mouse FAM176B should be stored under the following conditions to maintain stability and activity:

  • Store lyophilized protein at -20°C to -80°C for long-term storage

  • After reconstitution, aliquot to minimize freeze-thaw cycles

  • Use a manual defrost freezer and avoid repeated freeze-thaw cycles, which can compromise protein integrity

  • For short-term use (1-2 weeks), store reconstituted protein at 4°C

  • Add carrier proteins such as BSA (0.1-1%) to enhance stability in solution for dilute preparations

These storage protocols help maintain protein activity and structural integrity for extended periods.

How should Recombinant Mouse FAM176B be reconstituted for optimal activity?

For proper reconstitution of lyophilized Recombinant Mouse FAM176B:

  • Allow the protein vial to reach room temperature before opening

  • Reconstitute in sterile PBS to a concentration of approximately 500 μg/mL

  • Gently mix by rotating or inverting the vial until completely dissolved; avoid vigorous shaking or vortexing

  • For certain applications, consider adding a carrier protein such as 0.1% BSA if the protein will be diluted below 100 μg/mL

  • Allow the protein to sit for 15-30 minutes after reconstitution before use to ensure complete solubilization

Proper reconstitution ensures maintenance of protein structure and biological activity for experimental applications.

What are the recommended experimental applications for Recombinant Mouse FAM176B?

Recombinant Mouse FAM176B can be utilized in various experimental applications similar to other recombinant proteins:

  • As a standard in quantitative ELISA assays for measuring endogenous protein levels

  • In Western blot analysis as a positive control for antibody validation

  • For in vitro binding studies to identify interaction partners

  • In cell culture experiments to assess biological activities and cellular responses

  • For antibody production as an immunogen

  • In structural studies including crystallography or NMR spectroscopy

Each application requires specific consideration of protein concentration, buffer conditions, and experimental design parameters.

How can Recombinant Mouse FAM176B be used in cell-based assays?

When implementing cell-based assays with Recombinant Mouse FAM176B:

  • Determine appropriate concentration ranges through dose-response experiments (typically 0.1-10 μg/mL based on similar proteins)

  • Include proper controls, including untreated cells and cells treated with irrelevant proteins of similar size

  • Consider pre-conditioning the protein in culture media containing serum for 30 minutes before cell treatment

  • Evaluate multiple timepoints to capture both early and late cellular responses

  • Use complementary assays (e.g., Western blotting, flow cytometry, immunofluorescence) to validate observations

These methodological considerations enhance the reliability and reproducibility of cell-based experiments.

What strategies can address poor solubility of Recombinant Mouse FAM176B?

If experiencing solubility issues with Recombinant Mouse FAM176B:

  • Adjust the reconstitution buffer pH (try ranges between pH 6.8-8.0)

  • Add low concentrations of non-ionic detergents (0.01-0.05% Tween-20) to prevent aggregation

  • Increase the ionic strength of the buffer through addition of NaCl (up to 150-300 mM)

  • Consider reconstituting at lower concentrations initially (100-200 μg/mL) before diluting to working concentration

  • Implement gentle filtration through low protein-binding 0.22 μm filters if particulates persist

  • For severe aggregation, consider adding mild denaturants like 1-2 M urea followed by gradual dialysis

These approaches can significantly improve protein solubility while maintaining structural integrity.

How can researchers address inconsistent results when working with Recombinant Mouse FAM176B?

To improve reproducibility with Recombinant Mouse FAM176B experiments:

  • Implement stringent quality control measures for each protein lot using SDS-PAGE and activity assays

  • Standardize preparation protocols, including consistent reconstitution procedures

  • Create a detailed data table recording experimental parameters as shown below:

Experiment DateProtein LotReconstitution BufferStorage DurationExperimental OutcomeNotes
  • Minimize freeze-thaw cycles by preparing single-use aliquots

  • Validate protein activity using established functional assays before key experiments

  • Control for environmental variables like temperature and humidity during sensitive assays

This systematic approach facilitates identification of variables contributing to inconsistent results.

How does the His-tag affect the functional properties of Recombinant Mouse FAM176B?

The N-terminal His-tag present on Recombinant Mouse FAM176B can potentially impact:

  • Protein folding dynamics, especially if the N-terminus is involved in structural elements

  • Binding interactions with partner proteins or receptors if the tag introduces steric hindrance

  • Enzymatic activity if the protein possesses catalytic functions sensitive to N-terminal modifications

  • Crystallization behavior during structural studies

For critical applications where the tag might interfere, researchers should consider:

  • Using tag-removal strategies via engineered protease sites

  • Comparing results with alternatively tagged versions (C-terminal or internal tags)

  • Validating findings with native (untagged) protein if available

  • Implementing computational modeling to predict potential tag interference

What advanced analytical techniques can characterize Recombinant Mouse FAM176B structure-function relationships?

To elucidate structure-function relationships of Recombinant Mouse FAM176B, consider these advanced techniques:

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map protein dynamics and ligand-binding interfaces

  • Surface plasmon resonance (SPR) or bio-layer interferometry (BLI) for quantitative binding kinetics

  • Circular dichroism (CD) spectroscopy to assess secondary structure composition

  • Thermal shift assays to evaluate stability under various buffer conditions

  • Small-angle X-ray scattering (SAXS) for solution-state structural information

  • Cross-linking mass spectrometry to identify interaction domains

These methods provide complementary insights into protein behavior that can inform experimental design and interpretation.

What future research directions are emerging for Recombinant Mouse FAM176B?

Emerging research with Recombinant Mouse FAM176B is focusing on several promising directions:

  • Development of structure-guided mutations to probe functional domains

  • Investigation of tissue-specific expression patterns and their correlation with physiological functions

  • Exploration of potential roles in signaling pathways through proteomic approaches

  • Comparative studies with human FAM176B to establish translational relevance

  • Integration of computational and experimental approaches to predict binding partners and functional networks

These research trajectories will expand our understanding of FAM176B biological significance and potential applications in both basic and translational research contexts.

How can researchers contribute to the knowledge base about Recombinant Mouse FAM176B?

Researchers can advance the field by:

  • Publishing standardized protocols for expression, purification, and functional characterization

  • Depositing structural data in public databases like the Protein Data Bank

  • Developing and sharing new antibodies or detection reagents specific to FAM176B

  • Creating knockout or conditional mouse models to study in vivo functions

  • Establishing collaborations across disciplines to investigate the protein from multiple perspectives

  • Implementing CRISPR-Cas9 approaches for endogenous tagging and live-cell imaging

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.