Recombinant Mouse Protein FAM19A5 (Fam19a5)

Shipped with Ice Packs
In Stock

Description

Introduction

Family with sequence similarity 19, member A5 (FAM19A5), also known as TAFA5, is part of the FAM19A family, which includes five highly homologous genes (FAM19A1-5) . These genes encode proteins of approximately 100 amino acids, characterized by conserved cysteine residues at specific positions . While FAM19A proteins show distant sequence homology to the CC-chemokine family member MIP-1α/CCL3, FAM19A5 is the least related among them, and its functions have only recently begun to be understood .

Functional Properties and Interactions

FAM19A5 has been implicated in various biological processes, including:

  • Vascular Smooth Muscle Cell Function: FAM19A5 can inhibit vascular smooth muscle cell proliferation and migration, as well as neointima formation after vascular injury . It interacts with sphingosine-1-phosphate receptor 2 (S1PR2) on vascular smooth muscle cells, suppressing their activation via the S1PR2-G12/13-RhoA signaling pathway .

  • Macrophage Activity: FAM19A5 stimulates chemotactic migration of bone-marrow-derived macrophages (BMDMs) through pertussis toxin (PTX)-sensitive G-proteins . It also promotes macrophage chemotaxis via formyl peptide receptor 2 (FPR2) and inhibits RANKL-induced osteoclast differentiation .

  • Synaptic Function: FAM19A5 interacts with leucine-rich repeat-containing 4B (LRRC4B), a postsynaptic cell adhesion molecule, influencing synapse formation and elimination in neurons . This interaction inhibits the binding of LRRC4B to protein tyrosine phosphatase receptor type F (PTPRF), a presynaptic cell adhesion molecule .

Role in Cardiovascular Diseases

Given its ability to inhibit neointima formation, FAM19A5 may have a protective role against cardiovascular diseases . Overexpression of FAM19A5 attenuates neointima formation in injured rat carotid arteries, while silencing FAM19A5 in adipocytes promotes vascular smooth muscle cell activation . Adipose-specific FAM19A5 transgenic mice exhibit greater attenuation of neointima formation compared to wild-type mice . Further, circulating levels of FAM19A5 are inversely associated with carotid intima-media thickness, a marker of subclinical atherosclerosis .

FAM19A5 and the Central Nervous System

FAM19A5 is involved in the development and inflammation processes within the central nervous system and can affect synapse formation and elimination in neurons .

Data Tables

PropertyDescription
Gene FamilyFAM19A (Family with sequence similarity 19, member A)
Protein LengthApproximately 100 amino acids
Sequence HomologyDistantly related to CC-chemokine family member MIP-1α/CCL3
Primary LocationBrain
Other NamesTAFA5
FunctionRegulation of vascular smooth muscle cell function, macrophage activity, synaptic function
Receptor InteractionsSphingosine-1-phosphate receptor 2 (S1PR2), leucine-rich repeat containing 4B (LRRC4B), formyl peptide receptor 2 (FPR2)
StudyFindings
Wang et al. (2018) FAM19A5 inhibits neointima formation via S1PR2-G12/13-RhoA signaling; downregulated in obese mice.
Kim et al. (2024) FAM19A5 interacts with LRRC4B, influencing synapse formation and elimination; primary expression in the central nervous system.
Yu et al. (2021) Circulating FAM19A5 levels are inversely associated with carotid intima-media thickness and reduced in individuals with type 2 diabetes.
Oh et al. (2017) FAM19A5 stimulates macrophage chemotaxis through FPR2 and inhibits RANKL-induced osteoclast differentiation.
Park et al. (2024) FAM19A5 contributes to synapse elimination by binding to leucine rich repeat containing 4B (LRRC4B) and treatment with an anti- FAM19A5 antibody restores the lost synapses in the hippocampal neurons.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag is required, please inform us, and we will prioritize its inclusion.
Synonyms
Tafa5; Fam19a5; Chemokine-like protein TAFA-5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-132
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Fam19a5
Target Protein Sequence
MAPSPRTSSRQDATALPSMSSTFWAFMILASLLIAYCSQLAAGTCEIVTLDRDSSQPRRT IARQTARCACRKGQIAGTTRARPACVDARIIKTKQWCDMLPCLEGEGCDLLINRSGWTCT QPGGRIKTTTVS
Uniprot No.

Target Background

Function
FAM19A5 functions as a chemokine-like protein, regulating cell proliferation and migration via G protein-coupled receptors (GPCRs), such as S1PR2 and FPR2. It stimulates macrophage chemotaxis through the MAPK3/ERK1 and AKT1 pathway, while simultaneously inhibiting TNFSF11/RANKL-induced osteoclast formation by suppressing the expression of osteoclast fusogenic and differentiation genes. Macrophage migration stimulation and osteoclast formation inhibition are mediated through the GPCR FPR2. FAM19A5 also acts as an adipokine, negatively regulating vascular smooth muscle cell (VSMC) proliferation and migration in response to platelet-derived growth factor stimulation. This regulation is achieved through GPCR S1PR2 and G protein GNA12/GNA13-mediated RHOA signaling. Ultimately, FAM19A5 inhibits injury-induced cell proliferation and neointima formation in femoral arteries.
Database Links

KEGG: mmu:106014

UniGene: Mm.244319

Protein Families
FAM19/TAFA family
Subcellular Location
Secreted.
Tissue Specificity
Expressed in the subcutaneous, brown, epididymal and perirenal adipose tissue (at protein level).

Q&A

What is the structural characterization of recombinant mouse FAM19A5?

FAM19A5 is a secreted protein predicted to be distantly related to the CC-chemokine family, with distinctive structural features that enable its diverse biological functions . The protein contains a 43-amino acid N-terminal signal peptide that is cleaved during secretion, which must be considered when designing recombinant expression systems . Three-dimensional modeling studies have revealed that FAM19A5 contains β-strand structures that can form specific interactions with binding partners through hydrogen bonds . A particularly notable structural feature is the ability of FAM19A5 to form a salt bridge between its Lys127 residue and Glu493 of its binding partner LRRC4B, which significantly contributes to the stability of this protein-protein interaction . This interaction causes a conformational change in LRRC4B's FB domain from a disordered structure to a β-strand that interacts with FAM19A5's β-strands .

For researchers working with recombinant FAM19A5, it is essential to ensure proper folding of the protein to maintain its functional activity. Validation methods should include N-terminal sequencing to confirm signal peptide cleavage, along with binding assays to verify interaction with known partners such as LRRC4B or sphingosine-1-phosphate receptor 2 (S1PR2) . Surface plasmon resonance (SPR) analyses have demonstrated that properly folded FAM19A5 exhibits nanomolar binding affinity to its receptors, providing a quantitative benchmark for recombinant protein quality assessment .

What is the tissue expression profile of FAM19A5 in mouse models?

In the central nervous system, FAM19A5 shows robust expression across multiple regions, with particularly notable expression in the hippocampus during critical developmental periods . At the cellular level, comprehensive analysis using X-gal staining in FAM19A5 LacZ knock-in reporter mice, combined with immunostaining for cell-type markers, has revealed that FAM19A5 is expressed in diverse neural cell populations including neurons, astrocytes, and oligodendrocyte precursor cells (OPCs) . These findings have been further corroborated by single-cell RNA sequencing data from both mouse and human brain samples .

For researchers investigating FAM19A5 function, understanding this tissue-specific expression pattern is crucial for experimental design and interpretation. The broad expression across multiple cell types suggests that FAM19A5 may have context-dependent functions that vary across different tissues and physiological states . When designing experiments targeting specific FAM19A5 functions, researchers should carefully consider the relevant tissue context and employ appropriate experimental models that reflect the physiological expression patterns of this protein.

How can researchers validate FAM19A5 knockout or transgenic mouse models?

Validation of FAM19A5 genetic models requires a multi-faceted approach combining molecular, biochemical, and functional assessments . At the genomic level, PCR-based genotyping should confirm the intended genetic modification, while transcript analysis using quantitative RT-PCR can verify the absence (in knockout models) or overexpression (in transgenic models) of FAM19A5 mRNA . For reporter models such as FAM19A5 LacZ knock-in mice, X-gal staining provides visualization of endogenous expression patterns across tissues and developmental stages .

Protein-level validation is essential and should include Western blotting of tissue lysates using validated anti-FAM19A5 antibodies to confirm protein absence or overexpression . For adipose-specific FAM19A5 transgenic models, tissue-specific expression should be confirmed by comparing FAM19A5 levels across multiple tissues . Functional validation should assess known biological activities of FAM19A5, such as its effects on vascular smooth muscle cell proliferation in vascular injury models or its impact on synapse formation in neuronal cultures .

When working with crossbred models, such as APP/PS1/FAM19A5LacZ+/- mice developed to study Alzheimer's disease mechanisms, researchers should ensure consistent genetic backgrounds through appropriate breeding strategies and include multiple control groups (wild-type, FAM19A5-deficient only, and AD model only) to distinguish specific effects of FAM19A5 modification from background strain influences . Phenotypic characterization should extend beyond the primary target tissues to include potential systemic effects, given FAM19A5's expression in multiple tissues . For longevity studies, as demonstrated with APP/PS1/FAM19A5LacZ+/- mice, which showed extended lifespan compared to APP/PS1 mice, proper colony management and blinded assessment are essential for reliable results .

What experimental approaches can detect FAM19A5-LRRC4B interactions?

Investigating the interaction between FAM19A5 and LRRC4B requires specialized molecular and biochemical techniques designed to capture and quantify protein-protein interactions . Surface plasmon resonance (SPR) represents a gold-standard approach for analyzing binding kinetics and determining affinity constants . A validated SPR protocol involves immobilizing 6xHis-LRRC4B(453-576) on a nitrilotriacetic acid (NTA) chip and flowing increasing concentrations of FAM19A5 (0.78, 1.56, 3.12, 6.25, and 12.5 nM) across the immobilized protein at a 30 μl/min flow rate . Association should be monitored for 180 seconds, followed by a 240-second dissociation phase, with appropriate regeneration steps between samples .

For identifying critical binding residues, custom-made mutant peptides with single amino acid substitutions can be employed in binding assays . This approach has been successfully used to systematically replace each residue in the FB domain of LRRC4B with alanine or asparagine to determine their contribution to FAM19A5 binding . Computational approaches complement experimental methods, with in silico residue scanning providing predictions of binding free energy changes associated with specific mutations .

Co-immunoprecipitation experiments using anti-FAM19A5 or anti-LRRC4B antibodies can verify the interaction in more complex biological samples, while functional assays in neuronal cultures can assess the downstream consequences of this interaction on synapse formation . The binding of FAM19A5 to LRRC4B disrupts the interaction between LRRC4B and PTPRF (a presynaptic cell adhesion molecule), inhibiting synapse formation . This functional outcome can be quantified through immunostaining for synaptic markers in primary neuronal cultures treated with recombinant FAM19A5 or anti-FAM19A5 antibodies .

What are the optimal conditions for primary neuronal cultures to study FAM19A5 function?

Establishing reliable primary neuronal cultures is crucial for investigating FAM19A5's effects on synapse formation and neuronal function . Cortical or hippocampal neurons from postnatal day 1 C57BL/6 pups provide an excellent model system, as they develop robust synaptic connections in vitro and express FAM19A5 and its binding partners . The culture protocol should begin with tissue dissection in Hank's buffered salt solution (HBSS), followed by digestion with 2.5% trypsin for 15 minutes at 37°C . After washing with HBSS, tissues should be gently triturated, and the dissociated cells plated on glass coverslips pre-coated with poly-D-lysine (50 μg/ml in borate buffer) .

Initial plating should use minimum Eagle's medium (MEM) supplemented with 0.5% glucose, 1 mM pyruvate, 1.2 mM L-glutamine, and 12% fetal bovine serum . After 6 hours, this medium should be replaced with neurobasal media containing 2% B-27 and 0.5 mM L-glutamine to support neuronal health and synapse development . Cultures should be maintained in a 5% CO2-humidified incubator at 37°C, with half the medium replaced every 3-4 days .

Temporal considerations are critical when studying FAM19A5's effects on synapse formation, as synaptogenesis occurs over specific developmental windows in culture . RNA-seq analysis of neurons at multiple timepoints (DIV 1, 3, 7, 10, and 16) can provide valuable insights into the transcriptional changes associated with synapse development and FAM19A5 function . For experimental manipulations, recombinant FAM19A5 protein or anti-FAM19A5 antibodies can be added at various timepoints to assess their effects on synapse formation, maintenance, or elimination . Quantification of synaptic changes should employ multiple complementary techniques, including immunostaining for pre- and post-synaptic markers, electron microscopy for ultrastructural analysis, and electrophysiological recordings to assess functional connectivity .

What are the methodological considerations for producing high-quality recombinant FAM19A5?

Producing functional recombinant FAM19A5 requires careful attention to expression systems, purification strategies, and quality control measures . Mammalian expression systems are strongly recommended over bacterial systems due to the requirement for proper folding and potential post-translational modifications of this secreted protein . Human embryonic kidney (HEK293) cells have been successfully employed for FAM19A5 expression, with transfection of expression vectors containing the full-length FAM19A5 coding sequence .

When designing expression constructs, researchers must account for the 43-amino acid N-terminal signal peptide that is cleaved during secretion . Epitope or purification tags should be positioned to remain on the mature protein after signal peptide cleavage . For collection of secreted FAM19A5, serum-free media conditions minimize contamination with serum proteins while supporting cell viability during protein expression phases .

Purification should follow a multi-step chromatography approach, typically beginning with affinity chromatography using tag-based systems or specific anti-FAM19A5 antibody columns . Size exclusion chromatography serves as an essential second step to remove aggregates and confirm the oligomeric state of the purified protein . Ion exchange chromatography can further improve purity if needed . Throughout the purification process, careful monitoring of protein stability and prevention of aggregation are essential, potentially requiring the optimization of buffer conditions including pH, ionic strength, and stabilizing additives .

Quality control of the final product should include N-terminal sequencing to confirm correct signal peptide cleavage, mass spectrometry to verify protein identity and assess potential modifications, and functional binding assays such as SPR to confirm interaction with known receptors like S1PR2 (Kd = 0.634 nmol/L) or LRRC4B . Proper storage conditions, typically involving flash freezing of aliquots and storage at -80°C, are crucial to maintain protein activity for subsequent experiments .

How can researchers design vascular injury models to assess FAM19A5's effects on neointima formation?

Investigating FAM19A5's vascular protective effects requires well-designed injury models that recapitulate pathological vascular remodeling while allowing precise quantification of outcomes . Two established models have proven effective: the balloon injury model in rat carotid arteries and the wire injury model in mouse femoral arteries . For the rat carotid artery balloon injury model, a 2F Fogarty catheter should be inserted through the external carotid artery and advanced to the common carotid artery, inflated to create controlled endothelial denudation and medial stretching, and then withdrawn . For the mouse femoral artery wire injury model, a straight spring wire is inserted into the femoral artery and advanced, then withdrawn to create endothelial denudation .

When assessing FAM19A5's effects, both gain-of-function and loss-of-function approaches should be employed . Gain-of-function can be achieved through adenoviral overexpression of FAM19A5 in the injured vessel wall or systemic administration of recombinant FAM19A5 protein . Loss-of-function approaches might include siRNA-mediated silencing in adipocytes (to reduce a physiological source of FAM19A5) or use of FAM19A5-deficient mice . To specifically investigate the contribution of adipose-derived FAM19A5, adipose-specific FAM19A5 transgenic mice provide a valuable model, with comparisons to wild-type littermates fed either normal or Western-style diets to assess the impact of metabolic status .

Outcome assessment should include histomorphometric analysis at appropriate timepoints after injury (typically 14-28 days), with vessel sectioning at multiple levels along the injured segment to obtain representative measurements . Key parameters include neointima area, media area, intima/media ratio, and lumen diameter . Immunohistochemical staining for proliferation markers (PCNA, Ki67), inflammatory mediators, and extracellular matrix components provides mechanistic insights . To investigate receptor-mediated mechanisms, experiments employing S1PR2 antagonists or S1PR2-deficient mice can help elucidate the dependency of FAM19A5's vascular effects on this specific receptor .

What approaches can quantify alterations in synaptic density following FAM19A5 manipulation?

Quantifying synaptic changes in response to FAM19A5 manipulation requires multi-level analysis combining molecular, structural, and functional approaches . At the molecular level, immunostaining for pre-synaptic (e.g., synapsin, synaptophysin) and post-synaptic (e.g., PSD-95, Homer) markers in primary neuronal cultures or brain tissue sections provides a foundation for synapse quantification . High-resolution confocal microscopy followed by analysis of co-localized puncta using software such as ImageJ with appropriate plugins can provide reliable quantification of synaptic density .

For more detailed structural analysis, electron microscopy enables ultrastructural examination of synaptic contacts, including assessment of synapse morphology, postsynaptic density thickness, and presynaptic vesicle organization . This approach is particularly valuable for distinguishing between effects on synapse formation, maturation, or elimination following FAM19A5 treatment or genetic manipulation . Array tomography, combining ultrathin sectioning with immunofluorescence, offers another high-resolution approach for quantifying synapses across three dimensions .

Functional assessment of synaptic changes should include electrophysiological recordings such as miniature excitatory postsynaptic currents (mEPSCs) and miniature inhibitory postsynaptic currents (mIPSCs), which reflect the number and strength of functional synapses . Calcium imaging provides complementary data on neuronal activity patterns following FAM19A5 manipulation .

For in vivo assessment, techniques such as Golgi staining for dendritic spine analysis or viral labeling of specific neuronal populations can be employed to examine synaptic changes in FAM19A5 knockout mice or following antibody-based interventions . When designing these experiments, it is critical to include appropriate controls and time points, as FAM19A5's effects on synapse elimination involve disruption of LRRC4B-PTPRF interactions, which may show temporal specificity during development or in disease contexts .

How should researchers design experiments to evaluate FAM19A5-targeting therapies in Alzheimer's disease models?

Evaluating FAM19A5-targeting therapies in Alzheimer's disease models requires careful experimental design addressing multiple dimensions of disease pathology and cognitive function . When selecting AD models, researchers should consider the specific aspects of pathology most relevant to FAM19A5's proposed mechanisms . The APP/PS1 mouse model provides a standard system with progressive amyloid pathology, while the 5XFAD model exhibits more rapid Aβ accumulation, making it suitable for studying early intervention strategies .

For genetic approaches, generating APP/PS1/FAM19A5LacZ+/- mice (with partial FAM19A5 deficiency) has proven effective in demonstrating reduced Aβ plaque density and extended lifespan compared to APP/PS1 controls . For antibody-based interventions, key parameters include determining optimal dosing regimens, administration routes, and treatment duration . Intravenous administration of anti-FAM19A5 antibodies has shown efficacy in improving cognitive performance in both APP/PS1 and 5XFAD models .

Comprehensive outcome assessment should include both neuropathological and behavioral endpoints . For pathological assessment, quantification of Aβ plaque burden is essential, using immunohistochemistry with appropriate antibodies followed by stereological analysis or automated quantification methods . Additional markers of neurodegeneration, inflammation, and synaptic density provide a more complete picture of therapeutic effects .

Cognitive assessment should employ multiple behavioral paradigms sensitive to hippocampal and cortical function . The novel object recognition (NOR) test has demonstrated sensitivity to FAM19A5-targeted interventions and should follow a standardized protocol: habituation (5 minutes twice daily for 3 days), training (10 minutes with two identical objects), and testing (after 6 hours, with one novel object) . Video tracking during the test session enables precise quantification of exploration time for novel versus familiar objects . The Y-maze test provides complementary assessment of spatial working memory through measurement of spontaneous alternation behavior, which has shown improvement following anti-FAM19A5 antibody treatment in 5XFAD mice .

What methodological approaches can identify novel FAM19A5 binding partners?

Identifying FAM19A5 binding partners requires systematic application of complementary techniques spanning from in silico prediction to experimental validation . Affinity purification coupled with mass spectrometry (AP-MS) provides a powerful initial approach to discover potential interaction partners . This technique involves immobilizing purified recombinant FAM19A5 on an affinity matrix, incubating with cell or tissue lysates, washing to remove non-specific binders, and analyzing bound proteins by mass spectrometry . Brain tissue lysates are particularly relevant given FAM19A5's neurological functions, though adipose tissue should also be considered given its expression pattern .

Proximity-dependent biotin identification (BioID) offers an alternative approach for detecting transient or weak interactions . This technique involves expressing FAM19A5 fused to a promiscuous biotin ligase in relevant cell types, allowing biotinylation of proximal proteins that can then be purified and identified by mass spectrometry . For secreted FAM19A5, the BioID construct should include the signal peptide to ensure proper secretion and localization .

Computational approaches complement experimental methods, with protein-protein interaction prediction algorithms providing candidates for targeted validation . Such in silico approaches successfully predicted LRRC4B as a FAM19A5 binding partner, later confirmed experimentally . For receptor identification, radioactive ligand-receptor binding assays, receptor internalization, and calcium mobilization assays have proven effective, as demonstrated by the identification of sphingosine-1-phosphate receptor 2 as a functional receptor for FAM19A5 .

Validation of identified interactions should employ multiple complementary techniques . Surface plasmon resonance provides quantitative measurement of binding kinetics and affinity, as demonstrated for the FAM19A5-LRRC4B interaction . Co-immunoprecipitation from relevant tissues or cells confirms interactions in more physiological contexts . Functional validation through cellular assays examining the consequences of disrupting specific interactions provides the ultimate evidence of biological relevance .

What are the considerations for developing therapeutic anti-FAM19A5 antibodies?

Development of therapeutic anti-FAM19A5 antibodies requires careful consideration of multiple parameters including immunization strategies, antibody engineering, epitope selection, and functional validation . For initial antibody generation, immunization of chickens (Gallus gallus domesticus) with purified recombinant FAM19A5 has proven successful . This approach yielded chimeric chicken/human monoclonal antibodies that were subsequently deimmunized and optimized through amino acid substitution to generate candidates such as NS101 and SS01 .

Comprehensive epitope mapping is essential for therapeutic antibody development . A successful approach involves dividing the FAM19A5 linear sequence into discrete segments (labeled F1 to F6) and testing antibody binding to each segment . Further refinement should include alanine scanning mutagenesis, where each single residue in the identified epitope region is replaced with alanine to determine critical binding residues . This detailed epitope characterization enables selection of antibodies targeting functional domains of FAM19A5 rather than merely binding to non-functional regions .

For therapeutic applications, antibodies must demonstrate functional blocking activity . In vitro assays should assess the antibody's ability to block FAM19A5 interactions with identified partners such as LRRC4B . The capacity of anti-FAM19A5 antibodies to restore synapses lost due to FAM19A5-mediated disruption of LRRC4B-PTPRF interactions provides a valuable functional readout . For central nervous system applications, consideration of blood-brain barrier penetration is crucial, and antibody engineering strategies to enhance CNS delivery may be necessary .

In vivo efficacy should be demonstrated in relevant disease models . Intravenous administration of anti-FAM19A5 antibodies to APP/PS1 or 5XFAD mice has shown promising results, improving cognitive performance in behavioral tests such as novel object recognition and Y-maze spontaneous alternation . These improvements correlated with reduced Aβ plaque burden, suggesting that antibody-mediated neutralization of FAM19A5 may mitigate Alzheimer's disease pathology .

How can FAM19A5's involvement in neuroinflammation be experimentally assessed?

Investigating FAM19A5's role in neuroinflammation requires integration of multiple experimental approaches spanning from cell culture systems to in vivo models . Given FAM19A5's predicted relationship to the CC-chemokine family, assessment of its potential immunomodulatory functions is particularly relevant . Primary microglial and astrocyte cultures provide foundational systems for examining direct effects of recombinant FAM19A5 on glial activation states . Treatment of these cultures with FAM19A5 followed by analysis of inflammatory marker expression (TNF-α, IL-1β, IL-6) by qPCR and ELISA can reveal pro- or anti-inflammatory effects .

For in vivo assessment, FAM19A5 knockout or transgenic mouse models can be challenged with inflammatory stimuli such as lipopolysaccharide (LPS) injection or crossed with neuroinflammation-prone disease models such as APP/PS1 mice . Multi-parameter flow cytometry analysis of isolated brain immune cells enables quantification of microglial and infiltrating immune cell populations and their activation states . Complementary immunohistochemical analysis should examine microglial morphology, density, and marker expression (Iba1, CD68, TMEM119) across brain regions with particular attention to the hippocampus, where FAM19A5 shows prominent expression .

FAM19A5's potential role in regulating immune cell chemotaxis, as suggested by its relationship to chemokines, can be investigated using transwell migration assays with microglia, macrophages, or lymphocytes responding to concentration gradients of recombinant FAM19A5 . The effects of anti-FAM19A5 antibodies on neuroinflammatory profiles provide insights into therapeutic mechanisms, particularly in Alzheimer's disease models where reduced Aβ plaque burden following antibody treatment may involve modulation of microglial clearance functions .

RNA-sequencing of brain tissue from FAM19A5-deficient mice compared to controls, with and without inflammatory challenges, can identify differentially expressed genes in inflammation-related pathways . Phosphoproteomic analysis following FAM19A5 treatment or inhibition may reveal signaling pathways linking this protein to inflammatory responses . These comprehensive approaches can establish whether FAM19A5 directly modulates neuroinflammatory processes, which may contribute to its effects in neurodegenerative contexts .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.