Recombinant Mouse Protein FAM210B (Fam210b)
Shipped with Ice Packs 
In Stock 
Description
Cancer Metastasis and Metabolic Reprogramming
-
Ovarian Cancer:
-
Lung Adenocarcinoma (LUAD):
Erythroid Differentiation and Iron Metabolism
Autoimmune Regulation
-
Systemic Lupus Erythematosus (SLE)-like Phenotypes:
Table 1: Experimental Models and Outcomes
Therapeutic Implications
-
Cancer: FAM210B restoration or PDK4/TOM70 pathway modulation may counteract metastasis .
-
Autoimmunity: Targeting ROS in CD71<sup>+</sup> erythroid cells could mitigate SLE-like symptoms .
-
Erythropoietic Disorders: Context-specific targeting required due to conflicting adult vs. developmental roles .
Research Gaps and Future Directions
-
Structural Biology: Detailed 3D structure of FAM210B remains uncharacterized.
-
Context-Dependent Localization: Mechanisms underlying inner vs. outer membrane localization require clarification.
-
Therapeutic Development: No small-molecule activators/inhibitors of FAM210B have been reported to date.
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Fam210b; Protein FAM210B, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-190
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Fam210b
Target Protein Sequence
MAGLLTLLGPAGRVSTRLRPLAPWLLGTATSCAPPLWALALSHPVPDARLLRTARGDCLS
RQEPNRTPEPGGGVTGTEKKLSRTQQLKKVFQEYGAVGVSMHIGISLVSLGIFYTVVSSG
IDMSAILLKLGFKESLVQSKMAAGTSTFVVAYAIHKLFAPVRISITLVSVPFVVRYFRSV
GLFKPPATKP
Uniprot No.
Target Background
Function
FAM210B plays a crucial role in erythroid differentiation. It is involved in cell proliferation and the suppression of tumor cell growth. Furthermore, it participates in the metabolic reprogramming of cancer cells in a PDK4-dependent manner.
Protein Families
FAM210 family
Subcellular Location
Mitochondrion. Mitochondrion outer membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in late erythroblast differentiation stages.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
