Recombinant Mouse Protein FAM26E (Fam26e)

Shipped with Ice Packs
In Stock

Description

Functional Roles

Key biological activities:

  • Acts as a pore-forming subunit of voltage-gated ion channels

  • Exhibits cation channel activity, particularly influencing calcium homeostasis

  • Shows preferential expression in immune organs (spleen, lymph nodes) compared to other FAM26 members predominantly expressed in the brain

Interactions:

Interaction TypePartner Proteins
Functional synergyCALHM3, TRPM1, ASIC1A
Structural associationTransmembrane protein complexes

Recombinant Production

Expression systems:

  • Produced in Mus musculus using HEK293 cells or mammalian expression systems

  • Purification tags: May include His, Avi, or Fc tags depending on application requirements

Key experimental uses:

  • Immunoassays: Serves as a control protein in Western blot (WB) and flow cytometry (FACS) when paired with antibodies like PA5-65133

  • Mechanistic studies: Used to investigate calcium signaling pathways in immune cells

  • Structural biology: Platform for transmembrane domain analysis due to conserved FAM26 family features

Performance data:

  • Antibody validation shows >90% specificity in blocking experiments at 100x molar excess

  • Detected in spleen-derived immune cells via RT-PCR and surface biotinylation assays

Comparative Analysis

Evolutionary conservation:

SpeciesUniProt IDIdentity vs Mouse
HumanQ8N5C174%
RatUnlisted74% (predicted)
ChickenUnlistedModerate homology

Challenges and Limitations

  • Low lentiviral transduction efficiency in bone marrow-derived dendritic cells (BMDCs)

  • No confirmed activating ligands identified for NK cell interaction pathways

  • Limited commercial availability of isoform-specific antibodies

Product Specs

Form
Lyophilized powder
Note: While we preferentially ship the format currently in stock, we are happy to accommodate any specific format requirements. Please indicate your preference in the order notes and we will do our best to fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery information.
Note: Our proteins are typically shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend centrifuging the vial briefly prior to opening to ensure the contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Calhm5; Fam26e; Calcium homeostasis modulator protein 5; Protein FAM26E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Calhm5
Target Protein Sequence
MDAFQSILKFFLNQKTAIGYSFMALLTVGSERLFSLVAFKCPCSVENTAYGLVFLFAPAW VLLILGFFLNNKAWRLFTGCCMNPKKIFPRRRCCRFFYVLGHIILSSLVAPVMWLSVALL NGTFYECAMSGTRSTRLLEMICKGKPKECWEELHKVSCGKSSMAAMESEEVRLSLQAQSQ ILGWCLICSASFLSLLTTCYARCRSKVSYLQLSFWKTYAQREKEQLENKLLECANKLSER NLKCFFENKKPDPFPMPSFGAWEAASELHSFHQDREHYSTLHKVVDDGMEQTPQEEETTM ILVGTAQSL
Uniprot No.

Target Background

Function
Pore-forming subunit of a voltage-gated ion channel.
Database Links

KEGG: mmu:103511

UniGene: Mm.66334

Protein Families
CALHM family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of mouse FAM26E and how does it compare to other FAM26 family members?

Mouse FAM26E belongs to the FAM26 gene family and is characterized by three to four transmembrane motifs, similar to other family members including FAM26A/CALHM3, FAM26B/CALHM2, FAM26C/CALHM1, FAM26D, and FAM26F/INAM . FAM26E is located on chromosome 10 in mice, along with FAM26D and FAM26F, while FAM26A, FAM26B, and FAM26C are positioned on chromosome 19 . Unlike some other family members, particularly CALHM1, FAM26E lacks the conserved Q/R/N site at the C-terminal end of the second transmembrane motif that is associated with ion channel properties controlling cytoplasmic calcium levels . This structural difference suggests potentially distinct functional roles compared to other family proteins.

What is currently known about the tissue expression profile of mouse FAM26E?

Based on comparative analysis with other FAM26 family members, FAM26E shows highest expression in brain tissues, similar to other FAM26 family members located on chromosome 10 . This expression pattern differs from family members like FAM26F/INAM, which demonstrates high expression in immune-related tissues such as spleen and lymph nodes . The brain-predominant expression suggests potential neurological functions, possibly related to cellular communication or signaling in neural tissues. Researchers should consider using single-cell RNA sequencing to further characterize expression patterns across specific brain cell populations when investigating FAM26E function.

What are the optimal methods for producing recombinant mouse FAM26E protein for experimental studies?

For recombinant FAM26E protein production, researchers should consider the following optimized protocol:

  • Expression System Selection: For membrane proteins like FAM26E with multiple transmembrane domains, mammalian expression systems (HEK293 or CHO cells) are recommended over bacterial systems to ensure proper folding and post-translational modifications.

  • Vector Design: Construct expression vectors containing:

    • Full mouse FAM26E coding sequence

    • Affinity tag (His, FLAG, or HA) preferably at the C-terminus to avoid interference with signal peptides

    • Fluorescent reporter (GFP) separated by an IRES sequence for monitoring expression efficiency

  • Purification Strategy: Employ a two-step purification approach:

    • Initial isolation using detergent-based membrane protein extraction (e.g., n-dodecyl-β-D-maltoside)

    • Affinity chromatography using tag-specific resins

    • Size exclusion chromatography for final purification

  • Quality Control Assessments:

    • Western blot analysis for protein identity and integrity

    • Circular dichroism for secondary structure confirmation

    • Dynamic light scattering for homogeneity assessment

For researchers transitioning from studying related proteins, note that the production methods used for FAM26F/INAM, which include lentiviral expression systems in BMDCs, may be adapted for FAM26E with appropriate modifications .

What detection methods provide the highest sensitivity and specificity for mouse FAM26E in experimental samples?

Optimal detection strategies for FAM26E should employ multiple complementary approaches:

  • Transcript-level detection:

    • Quantitative RT-PCR with carefully designed primers spanning exon-exon junctions

    • RNA-seq for comprehensive expression profiling

    • In situ hybridization for spatial localization in tissue sections

  • Protein-level detection:

    • Western blotting using validated antibodies (consider antibodies against conserved regions of FAM26 family proteins if FAM26E-specific antibodies are unavailable)

    • Immunofluorescence microscopy with cell membrane markers to confirm localization

    • Flow cytometry for quantitative assessment in single-cell suspensions

  • Functional detection:

    • Cell surface biotinylation followed by pull-down assays to confirm membrane localization, similar to techniques used for FAM26F/INAM

    • Calcium imaging if ion channel activity is suspected

Based on approaches used with FAM26F/INAM, researchers should prioritize validation of antibody specificity through knockout/knockdown controls to prevent cross-reactivity with other FAM26 family members .

How can CRISPR-Cas9 gene editing be optimized for studying FAM26E function in mouse models?

For effective CRISPR-Cas9 modification of FAM26E, researchers should implement this strategic approach:

  • Guide RNA Design:

    • Select at least 3-4 guide RNAs targeting early exons

    • Prioritize sequences with minimal off-target effects using predictive algorithms

    • Consider targeting conserved domains shared with other FAM26 family members for functional studies

  • Delivery Method Selection:

    • For in vitro studies: Lentiviral delivery systems similar to those used for FAM26F/INAM studies

    • For in vivo models: Electroporation for brain tissue targeting or zygote injection for germline modification

  • Verification Strategy:

    • Genomic PCR and sequencing

    • Protein expression analysis

    • Off-target effect assessment through whole-genome sequencing

  • Phenotypic Analysis Focus:

    • Neurological assessment (given brain expression pattern)

    • Electrophysiological measurements if ion channel function is suspected

    • Interaction studies with other membrane proteins

  • Rescue Experiments:

    • Re-expression of FAM26E to confirm phenotype specificity

    • Expression of other FAM26 family members to assess functional redundancy

The knockout approach has proven valuable in understanding FAM26F/INAM function in immune responses and could reveal similar insights for FAM26E in neural contexts .

What protein-protein interaction methods are most effective for identifying FAM26E binding partners?

For transmembrane proteins like FAM26E, conventional interaction methods must be modified:

  • Proximity-based Labeling Approaches:

    • BioID or TurboID fusion constructs with FAM26E to identify proximal proteins in living cells

    • APEX2 peroxidase fusion for spatial-specific labeling

  • Membrane-compatible Co-immunoprecipitation:

    • Crosslinking prior to cell lysis to stabilize transient interactions

    • Digitonin or n-dodecyl-β-D-maltoside detergents for membrane protein extraction

    • Anti-tag antibodies if using tagged recombinant FAM26E

  • Functional Interaction Screens:

    • Split-reporter assays (luciferase, GFP) optimized for membrane proteins

    • FRET/BRET analysis for direct interactions in living cells

  • Computational Prediction Integration:

    • Utilize structural homology with known FAM26 family members

    • Cross-reference with brain tissue-specific interactome databases

Based on findings with FAM26F/INAM, researchers should specifically investigate potential interactions with immune receptors if exploring FAM26E function in neuroinflammatory contexts .

What evidence exists for FAM26E involvement in calcium signaling, and how can this be experimentally validated?

While direct evidence for FAM26E in calcium signaling is limited, several approaches can be employed to investigate this potential function:

  • Comparative Analysis with FAM26 Family Members:

    • Although FAM26E lacks the Q/R/N calcium-related site found in CALHM1, other structural features may confer alternative calcium-regulatory functions

  • Experimental Validation Methods:

    • Calcium imaging using fluorescent indicators (Fluo-4, Fura-2) in FAM26E-expressing cells

    • Patch-clamp electrophysiology to assess channel properties

    • Calcium flux measurements following various stimuli in wild-type vs. FAM26E-knockout models

  • Signaling Pathway Investigation:

    • Phosphorylation status analysis of calcium-dependent kinases

    • Transcriptional reporter assays for calcium-responsive elements

    • Protein localization changes in response to calcium modulators

  • Functional Consequences Assessment:

    • Neuronal activity measurements in primary cultures

    • Synaptic transmission analysis in brain slices

    • Behavior phenotyping of FAM26E-deficient mice

The apparent brain-specific expression of FAM26E suggests potential roles in neuronal calcium signaling that may differ from the immune functions observed with FAM26F/INAM .

How might FAM26E function in neurological disorders, and what research models are most appropriate for investigation?

Based on its predominant brain expression, FAM26E may have implications for neurological conditions:

  • Potential Neurological Functions:

    • Synaptic transmission regulation

    • Neuroinflammatory response modulation

    • Brain development pathways

    • Calcium homeostasis in specialized neural populations

  • Recommended Research Models:

    • Primary mouse neuron cultures with FAM26E overexpression or knockdown

    • Brain organoids from iPSCs for 3D functional studies

    • Conditional knockout mice with brain region-specific deletion

    • Mouse models of neurological disorders with FAM26E manipulation

  • Key Assessment Parameters:

    • Electrophysiological properties

    • Synaptic density and morphology

    • Calcium dynamics in response to stimuli

    • Behavioral phenotyping (cognitive, motor, social behaviors)

    • Neuroinflammatory marker expression

  • Translational Approaches:

    • Analysis of human FAM26E variants in neurological disorder cohorts

    • Correlation of expression levels with disease progression

    • Drug screening targeting FAM26E-related pathways

The membrane localization and potential signaling functions observed in FAM26 family proteins suggest that FAM26E might serve as a novel therapeutic target in neurological conditions if functional significance is established .

How does mouse FAM26E compare structurally and functionally with human FAM26E?

A comparative analysis between mouse and human FAM26E reveals important evolutionary insights:

FeatureMouse FAM26EHuman FAM26EImplications for Research
Sequence HomologyReferenceEstimated 75-80%*Moderate conservation suggests similar but potentially species-specific functions
Chromosomal LocationChromosome 10Chromosome 6Syntenic regions maintain evolutionary relationships
Tissue ExpressionPredominantly brainPredominantly brain*Conserved expression pattern suggests conserved function
Transmembrane Domains3-4 predicted3-4 predictedStructural conservation supports similar membrane topology
Regulatory ElementsTBDTBDSpecies-specific regulation may affect experimental design

*Based on extrapolation from FAM26F/INAM data, which shows 71.7% human-mouse homology

Researchers should consider:

The moderate homology observed between mouse and human FAM26 family members suggests caution when translating findings from mouse models to human applications .

How does FAM26E function compare to the better-characterized FAM26F/INAM within the FAM26 family?

The contrasting functions of these related proteins offer important research considerations:

AspectFAM26EFAM26F/INAMResearch Implications
Primary ExpressionBrain tissuesImmune tissues (spleen, lymph nodes)Suggests tissue-specific functions
InducibilityNot reportedInducible by TLR agonists (polyI:C)Different regulatory mechanisms
Functional RoleUnknown, possibly neurologicalNK cell activation, immune responseMay involve cell-cell contact in different contexts
Required PathwaysUnknownTICAM-1, IPS-1, IRF-3 dependentDifferent upstream signaling pathways
Cellular LocalizationPresumed membraneConfirmed cell surface membraneSimilar subcellular positioning

Based on FAM26F/INAM's function in cell-cell contact-mediated NK activation , researchers should investigate whether FAM26E plays analogous roles in neuron-neuron or neuron-glia interactions within the CNS. The requirement for cell-cell contact observed with FAM26F suggests potential membrane-localized signaling functions that might be conserved in FAM26E despite different tissue contexts .

What are the most common technical challenges in expressing and purifying functional recombinant FAM26E, and how can they be overcome?

Researchers face several obstacles when working with multi-transmembrane proteins like FAM26E:

  • Low Expression Yields:

    • Solution: Optimize codon usage for expression system

    • Solution: Use inducible promoters for controlled expression

    • Solution: Consider fusion tags that enhance stability (SUMO, MBP)

  • Protein Misfolding:

    • Solution: Reduce expression temperature (28-30°C)

    • Solution: Include chemical chaperones in culture media

    • Solution: Test multiple detergents for membrane extraction

  • Aggregation During Purification:

    • Solution: Include stabilizing agents (glycerol, specific lipids)

    • Solution: Optimize detergent concentration throughout purification

    • Solution: Consider nanodiscs or amphipols for final formulation

  • Functionality Assessment:

    • Solution: Develop cell-based assays using FAM26E-knockout cells

    • Solution: Test reconstitution in liposomes for functional studies

    • Solution: Use microscopy to confirm proper membrane localization

  • Antibody Specificity Issues:

    • Solution: Generate antibodies against divergent regions from other FAM26 family members

    • Solution: Validate all antibodies using knockout/knockdown controls

    • Solution: Consider epitope-tagged versions for detection

Based on approaches used with FAM26F/INAM, lentiviral expression systems may offer advantages for difficult-to-express transmembrane proteins, providing balanced expression levels that maintain functionality .

How can researchers effectively distinguish FAM26E function from other FAM26 family members in experimental settings?

Differentiating the specific functions of FAM26E requires methodical approaches:

  • Gene-specific Targeting Strategies:

    • CRISPR-Cas9 targeting of unique exons

    • siRNA/shRNA designed against divergent regions

    • Antisense oligonucleotides for specific knockdown

  • Expression Pattern Delineation:

    • Single-cell RNA sequencing to identify cell types expressing each family member

    • High-resolution in situ hybridization with paralog-specific probes

    • Temporal expression analysis during development

  • Functional Complementation Tests:

    • Rescue experiments in knockout models with individual family members

    • Domain-swapping between family members to identify functional regions

    • CRISPR activation/inhibition of specific family members

  • Protein Interaction Specificity:

    • Comparative interactome analysis between family members

    • Competition assays to identify shared vs. specific binding partners

    • Structural analysis of binding interfaces

  • Tissue-specific Function Assessment:

    • Take advantage of differential expression (FAM26E in brain vs. FAM26F in immune tissues)

    • Use tissue-specific promoters for conditional manipulation

    • Cross-tissue transplantation studies to test environmental influences

The differential expression patterns between FAM26E (brain-predominant) and FAM26F/INAM (immune tissue-predominant) provide a natural experimental advantage for distinguishing their functions in different physiological contexts .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.