Recombinant Mouse Protein FAM26F (Fam26f)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Calhm6; Fam26f; Calcium homeostasis modulator protein 6; Protein FAM26F
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-313
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Calhm6
Target Protein Sequence
MEKFKAVLDLQRKHRNALGYSLVTLLTAGGEKIFSSVVFQCPCTATWNLPYGLVFLLVPA LALFLLGYALSARTWRLLTGCCSRSARFSSGLRSAFVCAQLSMTAAFAPLTWVAVALLEG SFYQCAVSGSARLAPYLCKGRDPNCNATLPQAPCNKQKVEMQEILSQLKAQSQVFGWILI AAVIILLLLVKSVTRCFSPVSYLQLKFWEIYWEKEKQILQNQAAENATQLAEENVRCFFE CSKPKECNTPSSKDWQEISALYTFNPKNQFYSMLHKYVSREEMSGSVRSVEGDAVIPALG FVDDMSMTNTHEL
Uniprot No.

Target Background

Function
Pore-forming subunit of a voltage-gated ion channel.
Gene References Into Functions
  1. INAM plays a crucial role in IFN-gamma production by NK cells. PMID: 25320282
Database Links
Protein Families
CALHM family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is FAM26F and what is its subcellular localization?

FAM26F is a transmembrane protein that plays significant roles in immune response modulation. It is primarily located in the cytoplasm where it participates in cellular signaling and gene expression regulation . Research has shown that FAM26F is secreted through non-classical pathways rather than through conventional secretory mechanisms . This localization pattern is crucial for its function, as proper positioning within cellular compartments directly impacts its ability to participate in immune signaling cascades.

The protein's subcellular localization can be verified through experimental methods including immunofluorescence and subcellular fractionation followed by Western blotting. These techniques have confirmed its presence in the cytoplasmic region, which aligns with its proposed function in transmembrane signaling and calcium transport .

What are the key structural features of FAM26F protein?

FAM26F is a 315 amino acid protein with several distinctive structural characteristics:

  • Contains a single well-conserved Ca_hom_mod domain that indicates its function as a cation channel involved in molecular transport

  • Features at least one potential N-glycosylation site that may influence protein folding and stability

  • Contains approximately 14 predicted phosphorylation sites that likely regulate its activity and interactions

  • Possesses an immunoglobulin-like (Ig-like) fold that strongly suggests its involvement in immune response mechanisms

  • Lacks a classical signal peptide despite being secreted, indicating it utilizes non-conventional secretory pathways

The presence of these structural elements, particularly the Ig-like fold and Ca_hom_mod domain, provides important insights into FAM26F's potential mechanisms of action in immune modulation and calcium signaling.

How is FAM26F expression regulated at the transcriptional level?

FAM26F expression is primarily regulated through interferon signaling pathways, with distinct responses to different interferon types:

  • IFN-γ stimulation leads to a robust increase (approximately 40-fold) in FAM26F RNA levels within 6-12 hours, following kinetics similar to the interferon-responsive gene CXCL10

  • IFN-α2 stimulation produces a more modest increase (approximately 7-fold) in FAM26F expression

  • FAM26F RNA levels correlate significantly with plasma IFN-γ (Pearson r=0.7508, P=0.0031) but not with IFN-α levels (Pearson r=0.16, P=0.66)

  • Maximum transcript increase occurs approximately 6 hours after IFN-γ stimulation in cells pre-treated with low concentrations of ConA (10 ng/ml)

This regulation pattern establishes FAM26F as primarily an IFN-γ-responsive gene, although it demonstrates responsiveness to multiple interferon signaling pathways with varying intensities.

What is the proposed signaling mechanism of FAM26F?

Based on experimental evidence involving calcium and reactive oxygen species (ROS), FAM26F appears to function within a complex signaling cascade:

  • Environmental stimulation or stress conditions trigger extracellular Ca²⁺ influx as a primary immune cell response

  • This calcium influx activates protein kinase C, which subsequently activates NADPH oxidase

  • Activated NADPH oxidase (the "respiratory burst" enzyme) mediates excessive ROS release by generating inositol 1,4,5-trisphosphate (IP₃)

  • IP₃ activates IP₃ receptors, leading to calcium release from intracellular stores (endoplasmic reticulum and Golgi)

  • The increased intracellular calcium employs dual mechanisms for cellular oxidative response:

    • Activating NADPH oxidase respiratory burst

    • Inducing oxidation of thioredoxin (Trx)

This signaling pathway positions FAM26F as an important component in the regulation of calcium-mediated immune responses and oxidative signaling, particularly in contexts of cellular stress or immune activation.

What role does FAM26F play in viral infection outcomes?

Research with simian immunodeficiency virus (SIV) infection models has revealed significant correlations between FAM26F expression and viral control:

These findings suggest FAM26F may serve as a potential biomarker for predicting infection outcomes and could play a mechanistic role in viral control through immune modulation.

How does FAM26F contribute to immune system function?

FAM26F demonstrates multiple mechanisms of immune system involvement:

  • The presence of an Ig-like fold in FAM26F's structure suggests direct participation in immune recognition or response pathways

  • FAM26F can both respond to and amplify IFN-γ signaling, creating a potential positive feedback loop in immune activation

  • Synergistic expression of FAM26F on both NK-cells and myeloid dendritic cells is required for optimal NK-cell activation against tumors

  • Knockout studies in mice have demonstrated that FAM26F is necessary for efficient initial production of IFN-γ after polyI:C treatment and effective elimination of tumor cells

  • FAM26F expression increases significantly within 24 hours following viral vector immunization, indicating its early role in immune responses

These observations position FAM26F as a multifunctional immune modulator involved in both innate and adaptive immune processes, with particular importance in NK cell activation and interferon signaling networks.

What are the optimal conditions for detecting FAM26F expression in vitro?

Based on experimental findings, the following conditions have been identified for optimal FAM26F detection:

  • Peak expression occurs at 24 hours post-transfection in cell culture systems, as determined by MTS assay and Caspase-3 activity measurements

  • Cell viability increases with time and reaches maximum at 24 hours post-transfection, after which it declines and stabilizes

  • For protein detection, FAM26F antibodies compatible with multiple detection methods are available, including Western blotting, immunoprecipitation, immunofluorescence, and ELISA

  • For RNA detection, quantitative reverse transcription PCR (RT-PCR) has been successfully employed to measure differential expression in various cell populations

  • IFN-γ stimulation (6-12 hours) provides an effective method for upregulating FAM26F expression for experimental analyses

These parameters provide a useful framework for designing experiments aimed at investigating FAM26F function or expression under various conditions or treatments.

What detection methods are most effective for studying FAM26F?

Multiple complementary methods have proven effective for FAM26F detection:

MethodApplicationAdvantagesConsiderations
Western BlottingProtein expression levelsQuantifiable, size verificationRequires specific antibodies
ImmunoprecipitationProtein interactionsIdentifies binding partnersMay miss transient interactions
ImmunofluorescenceSubcellular localizationVisual confirmation of positionResolution limitations for membrane proteins
ELISAQuantitative measurementHigh sensitivity, throughputLimited to soluble or solubilized protein
RT-PCRmRNA expressionHighly sensitive, quantifiableDoesn't confirm protein expression
Cell viability assaysFunctional effectsAssociates expression with outcomesIndirect measurement of function

Selection of the appropriate method should be guided by the specific research question, with multiple approaches often providing more comprehensive insights into FAM26F biology.

How can I design effective experiments to investigate FAM26F's role in specific immune cell types?

For investigating FAM26F in immune contexts, consider the following experimental design principles:

  • Cell type selection:

    • Focus on NK cells and myeloid dendritic cells where FAM26F has demonstrated functional significance

    • Include CD8+ T cells which show differential FAM26F expression between controller and non-controller phenotypes

  • Stimulation protocols:

    • Use IFN-γ (primary inducer) and IFN-α (secondary inducer) at physiologically relevant concentrations

    • Consider pre-treatment with low ConA concentrations (10 ng/ml) to optimize response to IFN-γ

    • Include polyI:C treatment to model viral stimulation effects

  • Temporal considerations:

    • Design time-course experiments with special focus on the 6-24 hour window post-stimulation

    • Include both early (0-8 hours) and late (24+ hours) time points to capture the complete expression profile

  • Functional readouts:

    • Measure changes in calcium flux and ROS production as downstream indicators of FAM26F activity

    • Assess NK cell cytotoxicity against target cells to evaluate functional impact

    • Quantify interferon responses to determine feedback effects

  • Genetic manipulation approaches:

    • Consider siRNA knockdown or CRISPR-Cas9 knockout strategies to assess loss-of-function phenotypes

    • Implement overexpression systems to evaluate gain-of-function effects

    • Use domain-specific mutations to identify critical functional regions

What are the known interacting partners of FAM26F and how can they be validated?

  • Identification methods:

    • Affinity purification followed by mass spectrometry

    • Yeast two-hybrid screening

    • Proximity labeling techniques (BioID, APEX)

    • Co-immunoprecipitation coupled with antibody-based detection

  • Validation approaches:

    • Reciprocal co-immunoprecipitation experiments

    • Fluorescence resonance energy transfer (FRET) or bimolecular fluorescence complementation (BiFC)

    • Proximity ligation assay (PLA)

    • Functional studies demonstrating physiological relevance of interactions

  • Potential interaction domains:

    • Focus on the Ca_hom_mod domain which may mediate interactions with calcium signaling proteins

    • Investigate the Ig-like fold region for immune-related protein interactions

    • Examine the 14 predicted phosphorylation sites as potential regulatory interaction nodes

Understanding these interaction networks will provide critical insights into how FAM26F integrates into broader signaling cascades and functional pathways.

What are the implications of FAM26F in disease models beyond viral infection?

The literature suggests FAM26F may have implications in multiple disease contexts:

  • Cancer biology: FAM26F expression on NK cells and dendritic cells is required for NK cell activation against tumors, suggesting potential roles in anti-tumor immunity

  • Autoimmunity: Given its role in interferon signaling and immune activation, dysregulation might contribute to autoimmune conditions

  • Genetic disorders: The FAM26F gene is located on chromosome 6q22.1, a region associated with early-onset intestinal cancer and bipolar disorder susceptibility

  • Inflammatory conditions: As a mediator of calcium and ROS signaling, FAM26F likely influences inflammatory processes

Researchers investigating these disease connections should consider:

  • Examining FAM26F expression patterns in relevant patient samples

  • Assessing genetic variations in the FAM26F locus in disease cohorts

  • Developing animal models with FAM26F modifications to evaluate disease susceptibility

  • Investigating pharmacological approaches to modulate FAM26F activity in disease contexts

What are the key challenges in translating FAM26F research from mouse to human systems?

When translating FAM26F findings between species, researchers should consider:

  • Sequence and structural conservation:

    • While FAM26F is reported to be "well-conserved throughout evolution" , specific differences between mouse and human proteins may affect function

    • Particular attention should be paid to conservation of key domains (Ca_hom_mod, Ig-like fold) and modification sites

  • Expression pattern differences:

    • Potential variations in tissue-specific expression patterns between species

    • Differences in regulatory elements controlling expression

  • Experimental considerations:

    • Availability of species-specific detection reagents (antibodies, primers)

    • Variation in optimal experimental conditions between mouse and human systems

    • Differences in immune system architecture and function between species

  • Disease model relevance:

    • How well mouse models recapitulate human pathophysiology for studying FAM26F function

    • Whether viral infection dynamics (like those studied with SIV) translate accurately to human viral infections

Careful consideration of these factors will help researchers design appropriate translational studies and interpret findings accurately across species.

What are promising therapeutic applications targeting FAM26F?

Given its role in immune regulation and viral control, several therapeutic approaches involving FAM26F warrant investigation:

  • Enhancing anti-viral immunity:

    • Methods to upregulate FAM26F expression might improve control of viral infections

    • Pre-infection FAM26F levels correlate with better viral control, suggesting prophylactic applications

  • Cancer immunotherapy:

    • FAM26F's role in NK cell activation against tumors suggests potential for enhancing anti-tumor immunity

    • Combination approaches with existing immunotherapies could be explored

  • Inflammatory disease modulation:

    • Targeting FAM26F might help regulate excessive inflammatory responses

    • The calcium and ROS signaling pathways influenced by FAM26F represent important inflammatory control points

  • Biomarker applications:

    • FAM26F expression levels could serve as predictive biomarkers for infection outcomes or treatment responses

    • RNA level measurements might identify patients likely to benefit from specific therapeutic approaches

These applications will require further research to validate FAM26F as a therapeutic target and develop effective intervention strategies.

What genomic and transcriptomic approaches would advance our understanding of FAM26F regulation?

To better understand FAM26F regulation, researchers should consider:

  • Promoter analysis:

    • Characterize the FAM26F promoter region to identify transcription factor binding sites

    • Investigate epigenetic modifications that may influence expression

    • Perform reporter assays to validate regulatory elements

  • Single-cell transcriptomics:

    • Analyze FAM26F expression at single-cell resolution across immune populations

    • Identify cell types with highest expression or most dynamic regulation

    • Correlate expression with cellular activation states

  • eQTL analysis:

    • Identify genetic variants that influence FAM26F expression levels

    • Connect these variants to disease susceptibility or infection outcomes

  • Alternative splicing investigation:

    • Characterize potential alternative splice variants of FAM26F

    • Determine if splice variants have distinct functions or regulation

These approaches would provide a more comprehensive understanding of FAM26F regulation across cell types and physiological conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.