Recombinant Mouse Protein FAM70B (Fam70b)

Shipped with Ice Packs
In Stock

Description

What is Recombinant Mouse Protein FAM70B (Fam70b)?

Recombinant Mouse Protein FAM70B (Fam70b) is a protein coded by the FAM70B gene, which stands for family with sequence similarity 70, member B . The FAM70B gene is located on chromosome 13q34 and its function is protein coding . The precise mechanism of action of this gene has not been fully characterized in the field of oncological research . Recombinant Mouse Protein FAM70B (Fam70b) is produced through an in vitro E. coli expression system .

Characteristics:

  • Full Name: Family with sequence similarity 70, member B

  • Locus: Chromosome 13q34

  • Function: Protein coding

  • Production: In vitro E. coli expression system

Research Findings

FAM70B's expression level has been identified as a potential prognostic marker for muscle-invasive bladder cancer (MIBC) . Studies show that high FAM70B expression is predictive of cancer progression and cancer-specific death .

Key Findings:

  • Patients with low FAM70B expression have significant progression-free survival benefits compared to those with high expression (p=0.011) .

  • High FAM70B expression is associated with reduced cancer-specific survival (p=0.017) .

  • FAM70B expression is an independent predictor of cancer progression (HR, 2.115; p=0.013) and cancer-specific death (HR, 1.925; p=0.033) .

  • In patients who underwent radical cystectomy or received chemotherapy, FAM70B expression was a reliable biomarker for predicting cancer-specific survival and progression-free survival .

Data Tables:

Table 2. FAM70B Expression and Progression-Free Survival in MIBC

VariableHazard Ratio (HR)p-value
Gender2.1560.018
TNM Stage T4 or ≥N1 or M12.5710.003
FAM70B Expression2.1150.013

Table 3. FAM70B Expression and Cancer-Specific Death in MIBC

VariableHazard Ratio (HR)p-value
Gender2.1060.027
TNM Stage T4 or ≥N1 or M13.925<0.001
Chemotherapy0.5110.036
Radical Cystectomy0.5340.036
FAM70B Expression1.9250.033

Applications

Recombinant Mouse Protein FAM70B (Fam70b) is used in various research applications:

  • ELISA: It can be used as a recombinant protein in ELISA assays .

  • Prognostic Marker: FAM70B can be used to predict disease progression and cancer-specific survival in patients with MIBC .

  • Bioassays: It is used in bioassays with whole cells and tissues .

  • Other Applications: Research indicates it may play essential roles in cellular processes, particularly in cell cycle regulation and DNA repair mechanisms .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Tmem255b; Fam70b; Gm687; Transmembrane protein 255B; Protein FAM70B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-369
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Tmem255b
Target Protein Sequence
MVGAEGRWREKGNDQRRGRKKRGGVEESGHRAAFLETAGTLKPNHRAGGASGHCPPSGGH FGNAAAPTARARPSGSAGHHRGLCQEEEDLSVVCGLSPAGVYSHPDHWPCCNHQDRECDC GRLLPRDYFGAAIVFLSFGVVAAFCCAIVDSVFAARHIEPRPLSAGRCQFYSSGAGYLYD VYQTEVTCYSLNGRCQLKVRSNTCYCCDLYACGSTEPSPAYYEFVGVRSCQDVVHLYRLL WVSTVLNVLGLCLGIVTAAVLGAFKDMVPLSQLAYGPSPPPQILYNPAQQILAYTGLCPP SMGVPTCSSYPLPLQPSSAPPASASADLSLPEDTESPSQCQPSRGCSHAPSPCTPAYFLP GEKPPPYAP
Uniprot No.

Target Background

Database Links
Protein Families
TMEM255 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is FAM70B protein and what are its key molecular characteristics?

FAM70B (Family with sequence similarity 70 member B) is a protein that has been identified as a potential prognostic marker in cancer research, particularly in muscle-invasive bladder cancer (MIBC). The gene encodes a protein whose expression levels have shown significant correlation with cancer progression and patient survival outcomes in clinical studies .

Based on research data, FAM70B appears to play a role in cellular processes that influence cancer progression, though the exact molecular mechanisms remain under investigation. The protein can be detected experimentally using specific primers such as 5'-CCC TCG CCC GCC TAC TAT-3' and 5'-GCT GGG CGG GGT TGT AGA-3' for a 220 bp product in real-time PCR applications .

Current evidence suggests FAM70B may serve as a valuable biomarker for stratifying patient risk and potentially guiding treatment decisions, particularly in bladder cancer management where prognostic markers are needed for improved clinical decision-making.

How should recombinant mouse FAM70B protein be stored and handled for optimal stability?

While specific storage information for FAM70B is not directly provided in the sources, standard protocols for recombinant proteins can be applied based on similar recombinant mouse proteins:

Storage recommendations:

  • Store lyophilized protein at -20°C to -80°C in a manual defrost freezer to prevent degradation

  • Once reconstituted, aliquot the protein to avoid repeated freeze-thaw cycles

  • Short-term storage (1-2 weeks): 4°C

  • Long-term storage: -20°C to -80°C

Handling considerations:

  • Reconstitute lyophilized protein in sterile PBS at approximately 100 μg/mL

  • Allow the protein to dissolve completely through gentle agitation rather than vigorous vortexing

  • Avoid repeated freeze-thaw cycles as they may lead to protein degradation and loss of activity

  • Consider adding carrier proteins (such as 0.1-1% BSA) for dilute solutions to prevent adhesion to tubes

Shipping and transfer:

  • Similar recombinant proteins are typically shipped at ambient temperature

  • Upon receipt, store immediately at recommended temperatures

  • When transferring between laboratories, use dry ice for frozen samples

Documenting reconstitution date, concentration, buffer composition, and number of freeze-thaw cycles will help ensure experimental reproducibility when working with recombinant FAM70B.

What experimental controls should be included when studying FAM70B expression?

When designing experiments to investigate FAM70B expression, particularly in cancer research contexts, several critical controls should be incorporated:

For RNA-based detection:

  • Positive control: Sample with confirmed high FAM70B expression

  • Negative control: Sample with minimal FAM70B expression

  • No-template control: To detect potential contamination

  • Reverse transcriptase negative control: To detect genomic DNA contamination

  • Housekeeping gene controls: GAPDH, β-actin, or 18S rRNA for normalization

For protein-based detection:

  • Recombinant FAM70B protein as a positive control

  • Samples treated with FAM70B-specific siRNA as negative controls

  • Isotype controls for antibody specificity

For functional studies:

  • Wild-type cells alongside FAM70B-manipulated cells

  • Vector-only controls for overexpression studies

  • Non-targeting siRNA controls for knockdown studies

In cancer prognostic studies, include samples from patients with known outcomes and different disease stages to validate expression patterns against clinical endpoints . Research has demonstrated that FAM70B expression shows significant correlation with progression-free survival (p=0.011) and cancer-specific survival (p=0.017) in MIBC patients , making proper controls essential for accurate interpretation of results.

How does FAM70B expression correlate with cancer progression and patient outcomes?

Based on research in muscle-invasive bladder cancer (MIBC), FAM70B expression has demonstrated significant correlations with cancer progression and patient outcomes:

Statistical correlations with clinical outcomes:

Clinical ParameterStatistical SignificanceHazard Ratio (HR)p-value
Cancer ProgressionSignificant2.1150.013
Cancer-Specific DeathSignificant1.9250.033
Progression-Free SurvivalSignificant difference-0.011 (log-rank)
Cancer-Specific SurvivalSignificant difference-0.017 (log-rank)

Subgroup analyses:

In patients who underwent cystectomy, high FAM70B expression correlated with:

In patients who received chemotherapy, high FAM70B expression correlated with:

  • Poor cancer-specific survival (p=0.013)

  • Poor progression-free survival (p=0.042)

In patients with localized or locally advanced tumor stages, high FAM70B expression was associated with shorter cancer-specific survival (p=0.016) .

Multivariate Cox regression analysis confirmed that high FAM70B expression remains an independent predictor of cancer progression (HR 2.115, p=0.013) and cancer-specific death (HR 1.925, p=0.033) even after adjusting for other clinical variables .

These findings suggest FAM70B could serve as a valuable prognostic biomarker in MIBC management, potentially helping identify patients who might benefit from more aggressive treatment or closer surveillance.

What are the optimal methods for quantifying FAM70B expression in mouse tissue samples?

For accurate quantification of FAM70B expression in mouse tissue samples, researchers should consider these methodological approaches:

RNA-based quantification:

  • Real-time quantitative PCR (RT-qPCR):

    • Extract high-quality RNA using standard methods (RNeasy, TRIzol)

    • Use validated primers for mouse FAM70B:

      • Forward: 5'-CCC TCG CCC GCC TAC TAT-3'

      • Reverse: 5'-GCT GGG CGG GGT TGT AGA-3'

      • Amplicon size: 220 bp

    • Use SYBR Green or TaqMan chemistry for detection

    • Normalize to appropriate housekeeping genes (GAPDH, β-actin)

    • Consider using the comparative CT (ΔΔCT) method for relative quantification

  • Digital droplet PCR:

    • Consider for absolute quantification without reference standards

    • Particularly useful for samples with low expression levels

    • Same primers as for RT-qPCR

    • Provides higher precision for low-abundance transcripts

Protein-based quantification:

  • Western blotting:

    • Use tissue-specific protein extraction protocols with protease inhibitors

    • Validate antibody specificity with recombinant protein controls

    • Quantify using densitometry normalized to loading controls (β-actin, GAPDH)

    • Consider using recombinant FAM70B as a positive control

  • Immunohistochemistry:

    • Optimize fixation (typically 10% neutral buffered formalin)

    • Validate antibody specificity and optimization

    • Score expression using established systems (H-score, Allred score)

    • Include positive and negative control tissues

When analyzing cancer tissue samples, consider tumor heterogeneity by examining multiple regions and include normal adjacent tissue as controls. Standardization of collection and processing protocols is essential for consistent results across experiments.

What functional assays are most informative for studying FAM70B's role in cancer progression?

Based on FAM70B's association with cancer progression and patient outcomes , these functional assays would be most informative for characterizing its role:

Cell proliferation and viability assays:

  • MTT/MTS/WST-1 colorimetric assays to measure metabolic activity

  • BrdU incorporation to measure DNA synthesis

  • Colony formation assays to assess clonogenic potential

  • Cell cycle analysis by flow cytometry to determine cell cycle distribution

Migration and invasion assays:

  • Wound healing/scratch assays to measure collective cell migration

  • Transwell migration assays to quantify directed cell movement

  • Matrigel invasion assays to assess invasive potential

  • 3D spheroid invasion assays for more physiologically relevant models

Apoptosis and cell death assays:

  • Annexin V/PI staining for early/late apoptosis detection

  • Caspase activation assays

  • TUNEL assay for DNA fragmentation

  • Mitochondrial membrane potential assays

Molecular signaling assays:

  • Phospho-protein analysis (Western blot, ELISA) to examine pathway activation

  • Reporter gene assays to measure transcriptional activity

  • Co-immunoprecipitation to identify protein-protein interactions

  • RNA-seq after FAM70B manipulation to identify regulated genes

In vivo assays:

  • Xenograft tumor growth models with FAM70B-manipulated cells

  • Metastasis models to assess spread to distant sites

  • Patient-derived xenografts with varying FAM70B expression

  • Tumor microenvironment analysis (immune infiltration, angiogenesis)

Given FAM70B's significant correlation with progression-free survival and cancer-specific survival in MIBC patients , assays that focus on metastatic potential, treatment resistance, and cancer stem cell properties may be particularly informative for understanding its mechanistic contributions to poor clinical outcomes.

How should researchers design experiments to validate FAM70B as a prognostic biomarker?

To validate FAM70B as a prognostic biomarker, researchers should implement a comprehensive experimental design strategy:

Study cohort design:

  • Include adequate sample size based on power calculations

  • Ensure representative patient populations across disease stages

  • Collect comprehensive clinical data including treatment information

  • Include adequate follow-up duration to capture relevant outcomes

  • Consider prospective cohort studies after initial retrospective validation

Biospecimen considerations:

  • Standardize collection and processing protocols

  • Consider tissue heterogeneity through multiple sampling

  • Include matched normal tissue when available

  • Preserve specimens appropriately for multiple analysis methods

Expression analysis methodology:

  • Use validated primers for PCR-based detection (5'-CCC TCG CCC GCC TAC TAT-3' and 5'-GCT GGG CGG GGT TGT AGA-3')

  • Employ at least two independent detection methods (e.g., qPCR and IHC)

  • Include appropriate positive and negative controls

  • Ensure blinded assessment of expression levels

  • Standardize scoring methods and cutoff determination

Statistical analysis plan:

  • Define primary and secondary endpoints clearly

  • Pre-specify subgroup analyses

  • Use appropriate survival analysis methods (Kaplan-Meier, Cox regression)

  • Adjust for relevant clinical covariates in multivariable models

  • Consider competing risk analysis when appropriate

Validation approach:

  • Use training and validation cohorts

  • Consider external validation in independent patient populations

  • Evaluate performance metrics (HR, C-index, etc.)

  • Compare with established prognostic markers

Previous research has demonstrated that high FAM70B expression is predictive of cancer progression (HR 2.115, p=0.013) and cancer-specific death (HR 1.925, p=0.033) in MIBC patients , providing a foundation for further validation studies across different patient populations and cancer types.

What are common technical challenges when working with recombinant FAM70B and how can they be addressed?

Researchers working with recombinant proteins like FAM70B often encounter several technical challenges that require specific solutions:

Protein stability and storage issues:

  • Challenge: Loss of activity during storage or freeze-thaw cycles

  • Solution: Store as recommended in a manual defrost freezer and avoid repeated freeze-thaw cycles

  • Solution: Add stabilizing agents such as glycerol (15-25%) for frozen stocks

  • Solution: Prepare single-use aliquots after reconstitution

Solubility and aggregation:

  • Challenge: Protein aggregation after reconstitution

  • Solution: Reconstitute in recommended buffer (typically sterile PBS at specified concentration)

  • Solution: Consider adding low concentrations of non-ionic detergents if aggregation persists

  • Solution: Filter through 0.2 μm filter if visible particulates form

Protein adsorption to surfaces:

  • Challenge: Loss of protein through binding to tubes/pipettes

  • Solution: Use low-binding microcentrifuge tubes and pipette tips

  • Solution: Add carrier proteins like BSA (0.1-1%) to prevent adsorption

  • Solution: Pre-coat surfaces with BSA solution when carrier-free protein is required

Activity assay optimization:

  • Challenge: Variable activity in functional assays

  • Solution: Carefully titrate protein concentration in each assay

  • Solution: Include positive control protein with established activity

  • Solution: Monitor consistency of assay components (cell passage number, reagent lots)

Endotoxin contamination:

  • Challenge: Endotoxin interference with biological assays

  • Solution: Use endotoxin-tested preparations

  • Solution: Consider endotoxin removal procedures if detected

  • Solution: Include endotoxin testing as part of quality control

Fusion tag interference:

  • Challenge: Fusion tags may affect protein function

  • Solution: Compare activity of tagged vs. untagged protein

  • Solution: Consider tag removal if interference is detected

  • Solution: Design experiments to account for tag effects

When working with recombinant FAM70B for cancer research applications, maintaining consistent protein quality is essential for reliable results, particularly in studies evaluating its potential as a prognostic biomarker .

What considerations are important when designing FAM70B knockdown or overexpression experiments?

When manipulating FAM70B expression levels for functional studies, researchers should address these critical considerations:

Knockdown design:

  • Select appropriate siRNA/shRNA sequences targeting conserved regions of FAM70B

  • Include multiple targeting sequences to control for off-target effects

  • Validate knockdown efficiency at both mRNA and protein levels

  • Use non-targeting siRNA/shRNA controls with similar chemical modifications

  • Consider inducible systems for temporal control of knockdown

  • Determine optimal timepoint for functional assays based on protein half-life

Overexpression design:

  • Select appropriate expression vector (viral vs. non-viral)

  • Consider endogenous promoter vs. constitutive promoter effects

  • Include tag selection (if needed) that minimizes functional interference

  • Use empty vector controls processed identically to experimental samples

  • Validate expression levels by Western blot and qPCR

  • Assess potential toxicity from overexpression

Cell model selection:

  • Choose cell lines with detectable baseline FAM70B expression

  • Consider models relevant to bladder cancer where FAM70B's prognostic value has been demonstrated

  • Include multiple cell lines to ensure generalizability

  • Consider primary cells for physiological relevance

Experimental controls:

  • Include wild-type cells alongside manipulated cells

  • Process all samples identically to minimize technical variation

  • Consider rescue experiments to confirm specificity

  • Include positive controls for expected phenotypes

Functional readouts:

  • Select assays based on FAM70B's association with progression and survival

  • Include proliferation, migration, invasion assays

  • Measure apoptosis and treatment response

  • Analyze pathway activation states

  • Consider in vivo validation for key findings

Analysis and interpretation:

  • Quantify results using objective measurements

  • Perform statistical analysis appropriate for data type

  • Consider dose-dependent effects of varying expression levels

  • Correlate in vitro findings with clinical data on FAM70B expression

Given FAM70B's significant association with cancer progression (HR 2.115) and cancer-specific death (HR 1.925) , experiments should be designed to elucidate the molecular mechanisms underlying these clinical correlations.

How might FAM70B expression analysis be integrated into clinical practice for cancer patients?

Based on research demonstrating FAM70B's prognostic significance in MIBC , several approaches for clinical integration can be considered:

Risk stratification applications:

  • Incorporate FAM70B expression levels into prognostic nomograms

  • Use expression status to identify patients at high risk for progression

  • Apply in treatment planning for more aggressive approaches in high-expression cases

  • Develop clinical decision support tools integrating FAM70B with established markers

Implementation strategies:

  • Standardize testing methodology (RT-PCR vs. IHC)

  • Establish validated cutoff values for "high" vs. "low" expression

  • Create quality control programs for testing laboratories

  • Develop digital pathology algorithms for automated scoring

Specific clinical scenarios:

  • Post-cystectomy surveillance planning based on FAM70B status

  • Chemotherapy selection and intensity based on expression levels

  • Clinical trial eligibility determination

  • Monitoring response to therapy with serial measurements

Practical workflow integration:

  • Determine optimal timing for testing in patient journey

  • Establish turnaround time requirements

  • Define reflex testing algorithms

  • Create standardized reporting formats

Economic and implementation considerations:

  • Cost-effectiveness analysis for routine testing

  • Reimbursement strategy development

  • Laboratory resource requirements

  • Clinician education on result interpretation

With FAM70B showing significant prognostic value in specific subgroups such as post-cystectomy patients (p=0.013 for cancer-specific survival) and chemotherapy-treated patients (p=0.013 for cancer-specific survival) , targeted implementation in these populations may provide the most immediate clinical utility.

What are potential therapeutic strategies targeting FAM70B or its associated pathways?

While specific therapeutic targeting of FAM70B is still in early research stages, several potential approaches can be considered based on its role in cancer progression :

Direct targeting approaches:

  • Small molecule inhibitors of FAM70B activity or interactions

  • Antisense oligonucleotides to reduce FAM70B expression

  • siRNA-based therapeutics for transient knockdown

  • PROTAC technology for targeted protein degradation

  • Monoclonal antibodies (if accessible extracellular domains exist)

Indirect targeting strategies:

  • Identify and target synthetic lethal interactions with FAM70B expression

  • Block downstream effector pathways activated by FAM70B

  • Develop combination approaches targeting compensatory mechanisms

  • Epigenetic modulation of FAM70B expression

Clinical implementation considerations:

  • Patient selection based on FAM70B expression levels

  • Combination with standard therapies (particularly for chemotherapy-resistant disease)

  • Sequential treatment approaches

  • Monitoring strategies for treatment response

Potential clinical applications based on current data:

  • For patients with high FAM70B expression and poor prognosis after cystectomy (p=0.013)

  • For chemotherapy-treated patients with high expression and poor outcomes (p=0.042)

  • For patients with localized/locally advanced disease with high expression (p=0.016)

Development pathway:

  • Preclinical validation in relevant cell and animal models

  • Pharmacodynamic biomarker development

  • Early-phase clinical trials in FAM70B-high patient populations

  • Combination strategy development

Given the significant association between FAM70B expression and cancer progression (HR 2.115) , therapeutic targeting offers potential for addressing an unmet clinical need, particularly in patients with poor prognosis based on high expression levels.

How does FAM70B compare to other prognostic biomarkers for cancer progression?

When evaluating FAM70B against other established cancer biomarkers, several comparative aspects should be considered:

Performance metrics comparison:

BiomarkerCancer TypeHazard Ratio for ProgressionStatistical SignificanceReference
FAM70BBladder cancer (MIBC)2.115p=0.013
FAM70B (for cancer-specific death)Bladder cancer (MIBC)1.925p=0.033

Subgroup-specific performance:

FAM70B shows particularly strong prognostic value in specific clinical subgroups:

  • Post-cystectomy patients (p=0.013 for cancer-specific survival)

  • Chemotherapy-treated patients (p=0.013 for cancer-specific survival, p=0.042 for progression-free survival)

  • Localized/locally advanced stages (p=0.016 for cancer-specific survival)

This targeted prognostic value may offer advantages for specific clinical decision points compared to more general prognostic markers.

Analytical considerations:

  • Detection method standardization (RT-PCR using validated primers)

  • Sample requirements (tumor tissue)

  • Technical complexity of assessment

  • Turnaround time for results

Clinical utility factors:

  • Addition of independent prognostic information beyond standard clinical factors

  • Potential for guiding treatment decisions (particularly in chemotherapy selection)

  • Applicability across disease stages

  • Integration with existing clinical workflows

Implementation status:

  • Current status as research biomarker

  • Validation requirements for clinical use

  • Regulatory considerations

  • Availability of standardized testing

FAM70B's significant independent prognostic value for both cancer progression (HR 2.115, p=0.013) and cancer-specific death (HR 1.925, p=0.033) positions it as a promising biomarker particularly for specific clinical subgroups where treatment intensification decisions are critical.

What are the most important unanswered questions about FAM70B's molecular function in cancer?

Despite FAM70B's established prognostic significance in bladder cancer , several critical questions about its molecular function remain unanswered:

Fundamental molecular mechanisms:

  • What is FAM70B's primary molecular function (enzymatic activity, scaffold protein, etc.)?

  • Which signaling pathways are directly affected by FAM70B expression?

  • Does FAM70B function differ between normal and malignant cells?

  • Are there tissue-specific functions of FAM70B that explain its role in cancer?

Protein interaction network:

  • What are the key binding partners of FAM70B?

  • How do these interactions change during cancer progression?

  • Are there cancer-specific protein interactions that emerge?

  • Which domains of FAM70B are critical for its function?

Transcriptional regulation:

  • What regulates FAM70B expression in normal and cancer cells?

  • Are there specific transcription factors that drive its expression?

  • Does epigenetic regulation play a role in FAM70B expression?

  • How does FAM70B expression change in response to treatment?

Cancer-specific questions:

  • How does FAM70B contribute to resistance to therapy?

  • Is FAM70B expression associated with specific cancer subtypes?

  • Does FAM70B play different roles at different stages of cancer progression?

  • How does the tumor microenvironment affect FAM70B function?

Translational research priorities:

  • Can FAM70B expression be reliably detected in liquid biopsies?

  • Does FAM70B expression change during treatment, and does this change have prognostic value?

  • Are there specific mutations or variants of FAM70B associated with prognosis?

  • Can pharmacological modulation of FAM70B impact cancer progression?

Understanding these aspects would build upon the established prognostic value of FAM70B (HR 2.115 for progression, HR 1.925 for cancer-specific death) and potentially reveal new therapeutic opportunities for patients with FAM70B-high cancers.

What novel experimental models would advance our understanding of FAM70B's role in cancer?

To further elucidate FAM70B's contribution to cancer progression and potential as a therapeutic target, several novel experimental models should be developed:

Genetic models:

  • CRISPR-engineered FAM70B knockout cancer cell lines

  • Inducible FAM70B expression systems for temporal studies

  • Domain-specific mutant libraries to map functional regions

  • FAM70B reporter systems for live-cell monitoring

  • Knock-in models with tagged endogenous FAM70B

In vivo models:

  • Transgenic mouse models with tissue-specific FAM70B overexpression

  • Conditional FAM70B knockout mice for developmental studies

  • Patient-derived xenografts stratified by FAM70B expression levels

  • Orthotopic bladder cancer models with FAM70B manipulation

  • Metastatic models to study FAM70B's role in cancer spread

3D and co-culture systems:

  • Organoid models from normal and cancer tissues

  • Co-culture systems with stromal and immune components

  • Microfluidic tumor-on-a-chip systems

  • Scaffold-based 3D culture systems

  • Spheroid invasion models

High-throughput screening platforms:

  • CRISPR screens to identify synthetic lethal interactions

  • Drug sensitivity screens in FAM70B-high vs. low models

  • Protein interaction screens to map FAM70B interactome

  • Transcriptional profiling after FAM70B modulation

  • Phospho-proteomic analysis for pathway mapping

Clinical model systems:

  • Ex vivo culture of patient samples with FAM70B targeting

  • Circulating tumor cell isolation and characterization

  • Live tissue slice cultures with FAM70B manipulation

  • Matched pre/post-treatment samples for expression analysis

These advanced models would provide deeper insights into the biological basis of FAM70B's significant association with cancer progression (HR 2.115) and cancer-specific death (HR 1.925) , potentially revealing new therapeutic strategies for patients with poor prognosis due to high FAM70B expression.

How might multi-omics approaches enhance our understanding of FAM70B's role in cancer biology?

Integrative multi-omics approaches offer powerful strategies to comprehensively characterize FAM70B's role in cancer biology beyond its established prognostic value :

Genomic approaches:

  • Whole genome/exome sequencing to identify FAM70B mutations

  • Copy number variation analysis to detect FAM70B amplifications/deletions

  • ATAC-seq to examine chromatin accessibility at the FAM70B locus

  • Genome-wide association studies to identify FAM70B-related SNPs

  • ChIP-seq to map transcription factor binding at the FAM70B promoter

Transcriptomic analyses:

  • RNA-seq before and after FAM70B manipulation

  • Single-cell RNA-seq to identify FAM70B-expressing cell populations

  • Alternative splicing analysis to detect cancer-specific isoforms

  • miRNA profiling to identify FAM70B regulators

  • Spatial transcriptomics to map FAM70B expression in tumor architecture

Proteomic approaches:

  • Immunoprecipitation-mass spectrometry to identify binding partners

  • Phospho-proteomics to map signaling changes after FAM70B modulation

  • Protein turnover studies to determine FAM70B stability

  • Protein localization studies across cancer progression stages

  • Reverse phase protein arrays for pathway activation analysis

Metabolomic integration:

  • Metabolic profiling in FAM70B-high vs. low models

  • Flux analysis to identify FAM70B-dependent metabolic pathways

  • Lipidomics to detect membrane composition changes

  • Metabolic dependency screens in FAM70B-manipulated cells

Integrated analysis frameworks:

  • Network analysis linking FAM70B to cancer hallmarks

  • Causal inference modeling to identify key dependencies

  • Machine learning approaches to predict FAM70B-associated phenotypes

  • Multi-layer network visualization tools

  • Systems biology modeling of FAM70B-associated pathways

These multi-omics approaches could elucidate the molecular mechanisms underlying FAM70B's significant association with cancer progression (HR 2.115, p=0.013) and cancer-specific death (HR 1.925, p=0.033) , potentially revealing targetable vulnerabilities in tumors with high FAM70B expression.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.