Recombinant Mouse Protein FAM73A (Fam73a)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Miga1; Fam73a; Mitoguardin 1; Protein FAM73A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-600
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Miga1
Target Protein Sequence
MSDETVSRSQFSLKTYAVRVFALPVSWYYSLSQIKFSPVAKKLFMVTAVSAVSVIFLAHH FKRRRGKQKGKVLPWEPEHLLLEHTRRAASEKGSSCSSSRQNLTLSLSSTKEKGSQCCNY PNGGLLSRYSGSAQSLGSVQSVNSCHSCACGNSNSWDKADDDDIRLVNIPVTTPENLYLM GMELFEEALRRWEQALTFRSRQAEDEACSSVKLGAGDAIAEESVDDIISSEFIHKLEALL QRAYRLQEEFEATLGGSDPNSIANDTDKDTDMSLRETMDELGLPDAMNMDSADLFASATE LAEQREAQQTFSLESFCPCPFYEEAMHLVEEGKIYSRVLRTEMLECLGDSDFLAKLHCIR QAFQLILAEADNRSFLAESGRKILSALIVKARKNPKKFQDVFDEMINFLEQTDHWDSTEL ELAARGVKNLNFYDVVLDFILMDSFEDLENPPTSIQSVVNNRWLNSSFKESAVASSCWSV LKQKRQQMKISDGFFAHFYAICEHVSPVLAWGFLGPRNSLYDLCCFFKNQVLFFLKDIFD FEKVRYSSIDTLAEDLTHLLIRRTELLVTCLGADALRHATTCTSGHSHAVPTALLEAKVQ
Uniprot No.

Target Background

Function
FAM73A is a regulator of mitochondrial fusion. It functions by forming homo- and heterodimers at the mitochondrial outer membrane, facilitating the formation of PLD6/MitoPLD dimers. Its mechanism of action may involve regulating phospholipid metabolism via PLD6/MitoPLD.
Gene References Into Functions
  1. Studies on MIGA1/2 knockout mice indicate a crucial role for MIGA1/2 proteins in ovulation and ovarian steroidogenesis. Granulosa cells lacking Miga1/2 exhibited significant defects in luteinization and steroidogenesis, along with disrupted mitochondrial morphology and function in response to gonadotropins. PMID: 28938432
Database Links
Protein Families
Mitoguardin family
Subcellular Location
Mitochondrion outer membrane; Multi-pass membrane protein.

Q&A

What is FAM73A and what is its primary cellular function?

FAM73A (Family with sequence similarity 73 member A), also known as MIGA1, is a mitochondrial outer membrane protein that regulates mitochondrial fusion. It forms heterotypic complexes with FAM73B (MIGA2) to promote mitochondrial fusion events and maintain mitochondrial network homeostasis. FAM73A is expressed in various tissues including immune cells and plays a significant role in regulating cellular metabolism and immune responses. The protein contains specific domains that facilitate its interaction with the mitochondrial membrane and other fusion-promoting proteins .

What phenotypes are observed in FAM73A knockout mice?

FAM73A knockout (KO) mice demonstrate several notable phenotypes:

  • Enhanced production of pro-inflammatory cytokine IL-12 in macrophages, similar to FAM73B KO mice

  • Altered mitochondrial morphology with a preference for mitochondrial fission over fusion

  • Modified immune cell function, particularly in macrophages and dendritic cells

  • Potential enhancement of anti-tumor immune responses, as seen with FAM73B KO models

These phenotypes make FAM73A KO mice suitable models for evaluating the role of mitochondrial dynamics in immune homeostasis and host defense mechanisms .

How is FAM73A expression regulated in different cell types?

FAM73A expression appears to be under complex transcriptional control that varies by cell type and physiological state. In immune cells such as macrophages, its expression may be modulated by polarization signals and inflammatory stimuli. Transcription factors like E2F1 can influence FAM73A expression, similar to what has been observed with FAM73B and circular FAM73A RNA. Some research indicates that high-mobility group AT-hook 2 (HMGA2) may be involved in a feedback loop regulating FAM73A expression through enhancing E2F1 activity. The regulation may also involve epigenetic mechanisms and post-transcriptional modifications that respond to cellular metabolic states and external stimuli .

What is the relationship between FAM73A and circFAM73A?

CircFAM73A is a circular RNA derived from the FAM73A gene through a process called back-splicing. While the protein FAM73A functions in mitochondrial dynamics and immune regulation, circFAM73A serves distinct functions as a regulatory non-coding RNA. Research has shown that circFAM73A is upregulated in gastric cancer tissues and promotes cancer stem cell-like properties. It functions by regulating miR-490-3p/HMGA2 in a positive feedback loop and recruiting HNRNPK to stabilize β-catenin. This relationship demonstrates how a single genetic locus can generate multiple biomolecules with distinct functions—the protein contributing to mitochondrial dynamics and the circular RNA influencing cancer cell behavior .

How does FAM73A contribute to mitochondrial dynamics during immune cell polarization?

FAM73A plays a critical role in regulating mitochondrial morphology changes during immune cell polarization, particularly in macrophages. During polarization, immune cells undergo metabolic reprogramming that requires coordinated changes in mitochondrial network architecture. FAM73A promotes mitochondrial fusion, which is associated with oxidative phosphorylation and M2 (anti-inflammatory) macrophage polarization. When FAM73A is absent, mitochondria shift toward fission morphology, favoring glycolytic metabolism and M1 (pro-inflammatory) polarization.

Methodologically, this can be studied by:

  • Isolating bone marrow-derived macrophages from wild-type and FAM73A KO mice

  • Stimulating with polarizing cytokines (IFN-γ/LPS for M1, IL-4 for M2)

  • Tracking mitochondrial morphology changes using confocal microscopy with MitoTracker staining

  • Measuring oxygen consumption rate (OCR) and extracellular acidification rate (ECAR) to assess metabolic shifts

  • Analyzing polarization marker expression by flow cytometry and qRT-PCR

What are the molecular mechanisms by which FAM73A regulates IL-12 production?

FAM73A negatively regulates IL-12 production through several interconnected mechanisms related to mitochondrial dynamics:

  • Mitochondrial Morphology Regulation: FAM73A promotes mitochondrial fusion, which suppresses pro-inflammatory cytokine production including IL-12. When FAM73A is deleted, mitochondria favor fission, enhancing IL-12 production.

  • Parkin-IRF1 Axis: FAM73A-mediated mitochondrial fusion influences Parkin expression and recruitment to mitochondria. Parkin, an E3 ubiquitin ligase, regulates the stability of IRF1 (Interferon Regulatory Factor 1), a crucial transcription factor for IL-12 gene expression.

  • Metabolic Reprogramming: FAM73A deletion causes decreased oxidative phosphorylation activity, altering the metabolic state of immune cells to favor pro-inflammatory responses.

This can be experimentally investigated by:

  • Immunoblotting to detect Parkin levels and IRF1 stability

  • Chromatin immunoprecipitation (ChIP) to assess IRF1 binding to the IL-12 promoter

  • Metabolic flux analysis to monitor real-time changes in cellular metabolism

  • Rescue experiments with IRF1 inhibitors in FAM73A KO cells

What is the relationship between FAM73A and anti-tumor immunity?

FAM73A influences anti-tumor immunity through its effects on immune cell function and polarization:

  • Macrophage Polarization: FAM73A deletion shifts tumor-associated macrophages (TAMs) from an immunosuppressive M2-like phenotype toward a pro-inflammatory M1-like state.

  • Enhanced IL-12 Production: FAM73A deficiency leads to increased IL-12 production, which activates NK cells and T cells, promoting anti-tumor immunity.

  • T Cell Activation: In FAM73A knockout models, increased IL-12 from myeloid cells enhances IFN-γ production by CD4+ and CD8+ T cells, improving tumor cell recognition and killing.

  • Reduced Immunosuppressive Cell Populations: FAM73A deficiency reduces tumor-infiltrating myeloid-derived suppressor cells (MDSCs).

Experimental approaches to study this include:

  • Tumor challenge models in wild-type versus myeloid-specific FAM73A knockout mice

  • Flow cytometric analysis of tumor-infiltrating lymphocytes and myeloid cells

  • Cytokine profiling in tumor microenvironment

  • Adoptive transfer experiments to identify which immune cell populations mediate the anti-tumor effects

How do FAM73A and FAM73B cooperate to regulate mitochondrial fusion?

FAM73A and FAM73B form heterotypic complexes that collectively regulate mitochondrial fusion through the following mechanisms:

  • Outer Mitochondrial Membrane Interaction: Both proteins localize to the outer mitochondrial membrane and interact to form complexes that facilitate fusion events.

  • Coordination with Fusion Machinery: They likely interact with other known fusion proteins such as Mitofusins (MFN1/2), though interestingly, research suggests they operate through mechanisms distinct from Mitofusins.

  • Complementary Functions: While both proteins promote fusion, they appear to have non-redundant roles, as knockout of either produces similar phenotypes.

Research methodologies to investigate this cooperation include:

  • Co-immunoprecipitation to detect protein-protein interactions

  • Proximity ligation assays to visualize protein complexes in situ

  • Fluorescence recovery after photobleaching (FRAP) to examine mitochondrial dynamics

  • Electron microscopy to visualize ultrastructural changes in mitochondrial morphology

  • Reconstitution experiments with tagged variants to determine domains essential for heterocomplex formation

What role does FAM73A play in Toll-like receptor signaling pathways?

FAM73A functions as a negative regulator in Toll-like receptor (TLR) signaling pathways through its effects on mitochondrial dynamics:

  • TLR-Mediated Mitochondrial Morphology Switch: TLR stimulation normally triggers mitochondrial morphology to switch from fusion to fission. FAM73A resists this change, maintaining fusion state.

  • Impact on IL-12 Production: FAM73A suppresses TLR-induced IL-12 production across multiple TLR pathways (TLR3, TLR4, TLR7, TLR9).

  • Metabolic Regulation: FAM73A influences TLR-mediated metabolic reprogramming, affecting the balance between oxidative phosphorylation and glycolysis.

  • Intersection with Type I IFN Response: FAM73A deficiency surprisingly reduces inducible IFN-β expression despite enhancing IL-12, indicating complex regulatory mechanisms.

This can be studied using:

  • Stimulation of macrophages with various TLR ligands (LPS, polyI:C, R848, CpG)

  • qRT-PCR and ELISA analysis of cytokine production

  • Immunoblotting for TLR signaling molecules (NF-κB, IRFs, MAPKs)

  • Live-cell imaging of mitochondrial morphology changes during TLR stimulation

  • Metabolic flux analysis before and after TLR activation

What are the optimal conditions for expressing recombinant mouse FAM73A protein?

For optimal expression of recombinant mouse FAM73A protein, researchers should consider the following methodological approach:

Expression System Selection:

  • Mammalian expression systems (HEK293, CHO cells) often provide proper folding and post-translational modifications

  • Insect cell systems (Sf9, High Five) can yield higher protein amounts while maintaining eukaryotic processing

  • Bacterial systems (E. coli) may be used for non-membrane domains with appropriate solubility tags

Expression Construct Design:

  • Include a cleavable tag (His.MBP, GST, or SUMO) to aid purification and solubility

  • Consider codon optimization for the expression system

  • Design constructs with and without predicted transmembrane domains

  • Include TEV or PreScission protease sites for tag removal

Expression Conditions:

  • For mammalian/insect cells: Culture at 37°C (mammalian) or 27°C (insect) with reduced temperature (30°C for mammalian, 19-21°C for insect) during induction

  • For E. coli: Induce at OD600 0.6-0.8, reduce temperature to 16-18°C during induction

  • Test multiple induction times (4h, 16h, 24h, 48h)

Purification Strategy:

  • Initial affinity purification using the fusion tag

  • Tag cleavage under optimized conditions

  • Further purification via ion exchange and size exclusion chromatography

  • Buffer optimization to maintain protein stability

This approach mirrors successful protocols used for other mitochondrial membrane proteins like FAM73B, where researchers achieved functional protein expression as demonstrated by in vitro enzyme activity assays .

How can I verify the mitochondrial localization and fusion-promoting activity of FAM73A in cells?

To verify both mitochondrial localization and fusion-promoting activity of FAM73A, employ the following comprehensive approach:

For Mitochondrial Localization:

  • Fluorescence Microscopy:

    • Express fluorescently-tagged FAM73A (GFP/mCherry fusion) in FAM73A-knockout cells

    • Co-stain with MitoTracker and analyze colocalization using confocal microscopy

    • Calculate Pearson's correlation coefficient for quantitative assessment

  • Biochemical Fractionation:

    • Perform subcellular fractionation to isolate mitochondria

    • Conduct Western blot analysis using antibodies against FAM73A

    • Include controls: VDAC (outer mitochondrial membrane), TOM20 (outer membrane), Cytochrome C (intermembrane space), and GAPDH (cytosolic)

  • Immunogold Electron Microscopy:

    • Perform immunogold labeling with anti-FAM73A antibodies

    • Visualize precise mitochondrial membrane localization at ultrastructural level

For Fusion-Promoting Activity:

  • Morphological Assessment:

    • Transfect FAM73A-knockout cells with wild-type or mutant FAM73A

    • Quantify mitochondrial morphology (fragmented/intermediate/tubular) using confocal microscopy

    • Measure mitochondrial parameters: length, interconnectivity, form factor

  • Mitochondrial Fusion Assay:

    • Perform polyethylene glycol (PEG) cell fusion assay with cells expressing differently colored mitochondrial markers

    • Quantify content mixing as indicator of fusion events

    • Compare fusion rates between FAM73A-expressing and knockout cells

  • Functional Rescue Experiments:

    • Express wild-type FAM73A in knockout cells and assess restoration of mitochondrial network

    • Use domain mutants to identify regions essential for fusion activity

    • Compare with cells expressing known fusion proteins (MFN1/2) as positive controls

  • Live-Cell Imaging:

    • Conduct time-lapse microscopy to visualize dynamic fusion events

    • Calculate fusion and fission rates using photoactivatable mitochondrial markers

    • Compare rates in presence and absence of FAM73A

This multilateral approach provides comprehensive evidence for both localization and functional activity of FAM73A in mitochondrial fusion .

What methods are most effective for studying the interaction between FAM73A and FAM73B?

To thoroughly investigate the interaction between FAM73A and FAM73B, researchers should employ a combination of complementary techniques:

In Vitro Protein-Protein Interaction Studies:

  • Co-immunoprecipitation (Co-IP):

    • Express tagged versions of FAM73A and FAM73B in cells

    • Perform Co-IP using antibodies against either protein

    • Analyze precipitates via Western blotting to detect interaction

  • Pull-down Assays:

    • Generate recombinant purified proteins with different tags

    • Perform pull-down assays to confirm direct interaction

    • Use truncation mutants to map interaction domains

  • Surface Plasmon Resonance (SPR) or Bio-Layer Interferometry (BLI):

    • Quantitatively measure binding affinity (KD) and kinetics

    • Determine association and dissociation rates

    • Test effects of mutations on binding parameters

Cellular Interaction Studies:

  • Proximity Ligation Assay (PLA):

    • Visualize endogenous protein interactions in their native cellular context

    • Quantify interaction signals in different cellular compartments

    • Compare wild-type and mutant protein interactions

  • Förster Resonance Energy Transfer (FRET):

    • Generate fluorescent protein fusions (e.g., CFP-FAM73A and YFP-FAM73B)

    • Measure FRET efficiency as indicator of protein proximity

    • Perform acceptor photobleaching FRET for quantitative analysis

  • Bimolecular Fluorescence Complementation (BiFC):

    • Split a fluorescent protein and fuse halves to FAM73A and FAM73B

    • Fluorescence occurs only upon protein interaction

    • Map interaction domains using truncated constructs

Structural Biology Approaches:

  • X-ray Crystallography or Cryo-EM:

    • Determine 3D structure of the FAM73A-FAM73B complex

    • Identify specific residues at the interaction interface

    • Design rational mutations to disrupt binding

  • Cross-linking Mass Spectrometry:

    • Use chemical cross-linkers to capture transient interactions

    • Identify cross-linked peptides by mass spectrometry

    • Map interaction regions with residue-level resolution

These approaches, when used in combination, provide robust evidence for the physical interaction, mapping of interaction domains, and functional consequences of the FAM73A-FAM73B heterotypic complex formation in regulating mitochondrial dynamics .

What are the best approaches to measure FAM73A's impact on mitochondrial function?

To comprehensively assess FAM73A's impact on mitochondrial function, researchers should implement the following methodological approaches:

Mitochondrial Respiration and Bioenergetics:

  • Oxygen Consumption Rate (OCR) Measurement:

    • Use Seahorse XF Analyzer to measure basal respiration, ATP production, maximal respiration, and spare respiratory capacity

    • Compare wild-type and FAM73A-knockout cells with and without stimulation

    • Create the following data table for standardized analysis:

    ParameterWild-type (Basal)Wild-type (Stimulated)FAM73A KO (Basal)FAM73A KO (Stimulated)
    Basal OCRXX ± SDXX ± SDXX ± SDXX ± SD
    ATP-linked OCRXX ± SDXX ± SDXX ± SDXX ± SD
    Maximal OCRXX ± SDXX ± SDXX ± SDXX ± SD
    Spare CapacityXX ± SDXX ± SDXX ± SDXX ± SD
  • Extracellular Acidification Rate (ECAR):

    • Measure glycolytic function as complement to OCR

    • Assess metabolic flexibility by calculating OCR/ECAR ratio

Mitochondrial Membrane Potential:

  • Fluorescent Probe Analysis:

    • Use JC-1 or TMRM to assess mitochondrial membrane potential

    • Perform flow cytometry for population analysis

    • Conduct live-cell imaging for single-cell dynamics

Mitochondrial Dynamics:

  • Morphological Analysis:

    • Stain mitochondria with MitoTracker or antibodies against TOM20

    • Quantify parameters such as length, circularity, interconnectivity

    • Create a morphology distribution table:

    MorphologyWild-type (%)FAM73A KO (%)
    FragmentedXX ± SDXX ± SD
    IntermediateXX ± SDXX ± SD
    TubularXX ± SDXX ± SD
  • Fusion/Fission Rate Measurement:

    • Employ photoactivatable GFP (PA-GFP) to track mitochondrial content mixing

    • Calculate fusion events per unit time

Mitochondrial Quality Control:

  • Mitophagy Assessment:

    • Use mt-Keima or mito-QC reporters to quantify mitophagy events

    • Monitor PINK1/Parkin recruitment to damaged mitochondria

  • Reactive Oxygen Species (ROS) Production:

    • Measure mitochondrial ROS using MitoSOX or DCF-DA fluorescent probes

    • Quantify by flow cytometry or microplate reader

Mitochondrial DNA Stability:

  • mtDNA Copy Number Analysis:

    • Perform qPCR comparing mitochondrial to nuclear DNA ratio

    • Analyze in wild-type versus FAM73A-deficient cells

This comprehensive approach provides a multidimensional assessment of how FAM73A influences various aspects of mitochondrial function, particularly in the context of immune cell activation and metabolism .

How can I design experiments to study FAM73A's role in anti-tumor immunity?

To investigate FAM73A's role in anti-tumor immunity, design experiments using the following comprehensive approach:

In Vivo Tumor Models:

  • Syngeneic Tumor Challenge:

    • Inoculate B16 melanoma or other syngeneic tumor cells into:
      a. Wild-type mice
      b. Global FAM73A knockout mice
      c. Myeloid-specific FAM73A knockout mice (Fam73a^f/f Lyz2-Cre)
      d. T cell-specific FAM73A knockout mice (Fam73a^f/f Cd4-Cre)
      e. Dendritic cell-specific FAM73A knockout mice (Fam73a^f/f Itgax-Cre)

    • Monitor tumor growth, survival rates, and serum cytokine levels

    • Track outcomes in table format:

    Mouse ModelTumor Volume (Day 21)Survival Rate (Day 30)IL-12 Serum LevelsIFN-γ Serum Levels
    Wild-typeXX ± SD mm³XX%XX ± SD pg/mlXX ± SD pg/ml
    Global FAM73A KOXX ± SD mm³XX%XX ± SD pg/mlXX ± SD pg/ml
    Myeloid-specific KOXX ± SD mm³XX%XX ± SD pg/mlXX ± SD pg/ml
    T cell-specific KOXX ± SD mm³XX%XX ± SD pg/mlXX ± SD pg/ml
    DC-specific KOXX ± SD mm³XX%XX ± SD pg/mlXX ± SD pg/ml
  • Carcinogen-Induced Tumor Model:

    • Treat mice with methylcholanthrene (MCA) to induce fibrosarcoma

    • Compare tumor incidence and growth kinetics between genotypes

    • Monitor for 150+ days to assess long-term differences

Tumor Microenvironment Analysis:

  • Flow Cytometric Profiling:

    • Harvest tumors at different time points

    • Analyze immune infiltrate composition:

      • CD8+ T cells (CD3+CD8+)

      • CD4+ T cells (CD3+CD4+)

      • Regulatory T cells (CD4+Foxp3+)

      • TAMs (CD11b+F4/80+)

      • MDSCs (CD11b+Gr-1+)

      • Dendritic cells (CD11c+MHCII+)

    • Assess activation status (CD69, CD25, CD44, CD62L)

    • Measure intracellular cytokines (IFN-γ, TNF-α, IL-12)

  • Spatial Transcriptomics and Immunohistochemistry:

    • Map spatial distribution of immune cells within tumors

    • Correlate with FAM73A expression and mitochondrial morphology

Mechanistic Studies:

  • Ex Vivo Analysis of Tumor-Associated Macrophages:

    • Isolate TAMs from tumors in wild-type vs. FAM73A-deficient mice

    • Profile gene expression by qRT-PCR and RNA-seq

    • Measure cytokine production (ELISA, multiplex)

    • Analyze mitochondrial morphology and function

    • Co-culture with tumor cells to assess tumoricidal activity

  • T Cell Response Characterization:

    • Isolate T cells from tumor-draining lymph nodes and spleen

    • Measure antigen-specific T cell responses by ELISpot

    • Assess proliferation, cytotoxicity, and cytokine production

    • Perform adoptive transfer experiments to test T cell function

  • Therapeutic Intervention Studies:

    • Administer neutralizing antibodies (anti-IL-12, anti-IFN-γ) to define cytokine requirements

    • Test combination with checkpoint inhibitors (anti-PD-1, anti-CTLA-4)

    • Evaluate potential synergy with metabolic inhibitors

This experimental design allows for comprehensive assessment of FAM73A's role in anti-tumor immunity across multiple tumor models, with detailed mechanistic insights into which immune cell populations mediate the effects and through what molecular pathways .

How do I interpret conflicting data on FAM73A's role in inflammation versus anti-tumor immunity?

When encountering conflicting data regarding FAM73A's role in inflammation versus anti-tumor immunity, consider the following interpretative framework:

Contextual Analysis of Seemingly Contradictory Results:

  • Microenvironmental Differences:
    Analyze how experimental conditions differ between studies showing pro-inflammatory versus anti-inflammatory effects. The tumor microenvironment contains unique metabolic challenges, oxygen gradients, and cytokine milieus that may fundamentally alter FAM73A function compared to sterile inflammation models.

  • Cell Type-Specific Effects:
    Create a comparative table to analyze effects across different immune cell populations:

    Cell TypeEffect of FAM73A Deletion on InflammationEffect on Anti-tumor ImmunityPotential Reconciliation
    Macrophages↑ IL-12, ↓ IL-10 (pro-inflammatory)Enhanced tumor controlConsistent – pro-inflammatory phenotype beneficial in tumor context
    Dendritic Cells↑ IL-12, altered maturationImproved T cell primingConsistent – enhanced antigen presentation
    T CellsMay show minimal direct effectsSecondary effects via myeloid cellsIndirect mechanism explains differences
    Neutrophils[Data from your experiments][Data from your experiments][Your interpretation]
  • Temporal Dynamics:
    Different outcomes may reflect distinct time points in disease progression. Acute versus chronic inflammation models may reveal opposing roles of FAM73A.

Methodological Considerations:

  • Knockout Models:

    • Global versus conditional knockouts may yield different phenotypes

    • Developmental compensation in global knockouts might mask effects

    • Compare data from genetic ablation versus pharmacological inhibition

  • Experimental Readouts:

    • Cytokine measurements at different time points

    • Flow cytometry gating strategies and marker selection

    • In vitro versus in vivo models

Molecular Mechanism Reconciliation:

  • Signaling Pathway Analysis:

    • Map how FAM73A influences different signaling pathways in various contexts

    • Identify points of convergence/divergence in inflammation versus tumor immunity

  • Metabolic State Influence:

    • Characterize how metabolic conditions in tumors versus inflammatory sites affect FAM73A function

    • Measure metabolic parameters alongside inflammatory markers

  • Feedback Loop Analysis:

    • Investigate how initial FAM73A-mediated effects may trigger compensatory mechanisms

    • Perform time-course experiments to capture dynamic changes

Suggested Experimental Approaches to Resolve Conflicts:

  • Use the same FAM73A knockout model in parallel inflammation and tumor experiments

  • Employ single-cell RNA-seq to identify cell-specific responses

  • Perform adoptive transfer experiments to isolate cell-intrinsic effects

  • Compare acute versus chronic models to capture temporal dynamics

By systematically addressing these aspects, you can develop a more nuanced understanding of FAM73A's context-dependent functions rather than viewing the data as simply contradictory .

What could explain variability in FAM73A knockout phenotypes between different mouse strains?

Variability in FAM73A knockout phenotypes between different mouse strains can be systematically analyzed and explained through several key factors:

Genetic Background Influences:

  • Modifier Genes:
    Different mouse strains contain distinct alleles of genes that may modify FAM73A function or compensate for its loss. Create a comprehensive table comparing phenotypes across common backgrounds:

    Mouse StrainMitochondrial PhenotypeImmune PhenotypeTumor ResponsePotential Modifier Genes
    C57BL/6[Your data][Your data][Your data]Candidate genes based on strain-specific SNPs
    BALB/c[Your data][Your data][Your data]Candidate genes based on strain-specific SNPs
    129/Sv[Your data][Your data][Your data]Candidate genes based on strain-specific SNPs
    Mixed background[Your data][Your data][Your data]More variable due to heterogeneous genetics
  • Strain-Specific Mitochondrial Differences:
    Mouse strains naturally vary in mitochondrial function, network morphology, and metabolic preferences, which may interact with FAM73A deficiency:

    • Measure baseline mitochondrial respiration across strains

    • Compare mitochondrial DNA haplotypes

    • Assess baseline expression of other fusion/fission proteins

  • Immune System Variations:
    Strains have inherent differences in immune cell composition and cytokine production:

    • Th1 vs. Th2 bias (C57BL/6 tends toward Th1, BALB/c toward Th2)

    • Macrophage polarization tendencies

    • Natural killer (NK) cell activity

Methodological Considerations:

  • Knockout Strategy Impact:

    • Different targeting approaches (conventional KO vs. conditional KO)

    • Exons targeted and potential for alternative splicing

    • Knockout confirmation methods (protein vs. mRNA detection)

  • Housing Conditions and Microbiome:

    • Vendor-specific microbiome differences

    • SPF vs. conventional housing

    • Diet composition and feeding regimens

  • Experimental Design Variables:

    • Age of mice when analyzed (developmental compensation effects)

    • Sex differences in phenotype manifestation

    • Experimental stress and handling

Standardized Approach to Address Variability:

  • Backcrossing Strategy:

    • Backcross FAM73A knockout allele onto pure backgrounds (>10 generations)

    • Generate and compare congenic strains systematically

  • Controlled Breeding and Analysis:

    • Use littermate controls whenever possible

    • Analyze both males and females

    • Control for age effects with time-course studies

  • Multi-omic Profiling:

    • Perform comparative transcriptomics across strains

    • Analyze strain-specific proteomic and metabolomic profiles

    • Conduct quantitative trait locus (QTL) mapping to identify modifier genes

By systematically addressing these factors, researchers can not only understand sources of variability but also gain deeper insights into the context-dependent functions of FAM73A across different genetic backgrounds .

How should I troubleshoot issues with recombinant FAM73A protein solubility and stability?

When troubleshooting recombinant FAM73A protein solubility and stability issues, implement this systematic approach:

Initial Protein Expression Optimization:

  • Construct Design Refinement:

    • Map transmembrane domains and protein topology using bioinformatics tools

    • Create truncated constructs removing hydrophobic regions:

      • Full-length protein (control)

      • N-terminal domain only

      • C-terminal domain only

      • Constructs without predicted transmembrane regions

    • Test multiple fusion tags in parallel:

      • N-terminal: His6, His6-MBP, GST, SUMO, NusA

      • C-terminal: His6, StrepII, FLAG

  • Expression Condition Screening Matrix:
    Create a condition matrix varying these parameters:

    Expression HostTemperatureInducer ConcentrationDurationSolubility Result
    E. coli BL21(DE3)37°C1.0 mM IPTG4h[Your data]
    E. coli BL21(DE3)18°C0.1 mM IPTG16h[Your data]
    E. coli Rosetta218°C0.1 mM IPTG16h[Your data]
    E. coli SHuffle18°C0.1 mM IPTG16h[Your data]
    HEK29337°CN/A48h[Your data]
    Sf927°CN/A72h[Your data]

    Track soluble vs. insoluble protein fractions for each condition by SDS-PAGE and Western blot.

Solubilization and Purification Strategies:

  • Buffer Optimization:
    Test the following buffer conditions systematically:

    • pH range (6.0-9.0, in 0.5 increments)

    • Salt concentrations (100-500 mM NaCl)

    • Glycerol content (0%, 5%, 10%, 20%)

    • Detergent screening for membrane-associated domains:

      • Non-ionic: n-Dodecyl β-D-maltoside (DDM), Triton X-100

      • Zwitterionic: CHAPS, CHAPSO

      • Mild: Digitonin, LMNG

    • Stabilizing additives: Arginine (50-200 mM), Trehalose (5-10%)

  • Purification Protocol Optimization:

    • Adjust lysis conditions (sonication vs. homogenization vs. detergent lysis)

    • Implement step-wise purification:

      • Initial capture with affinity chromatography

      • Intermediate purification with ion exchange

      • Polishing with size exclusion chromatography

    • Test on-column refolding approaches for inclusion body-derived protein

Stability Assessment and Enhancement:

  • Thermal Stability Analysis:

    • Perform differential scanning fluorimetry (DSF) across buffer conditions

    • Test stability with additives using a thermal shift assay

    • Measure activity retention after temperature stress

  • Time-Course Stability Studies:

    • Monitor protein integrity at 4°C, -20°C, and -80°C over time

    • Test stabilizers: glycerol, arginine, trehalose, sucrose

    • Evaluate freeze-thaw stability across 1-5 cycles

  • Activity-Based Stability Assessment:

    • Develop a functional assay relevant to FAM73A's activity

    • Monitor activity retention over time as indicator of properly folded protein

Advanced Troubleshooting Approaches:

  • Co-expression with Binding Partners:

    • Co-express with FAM73B to stabilize through natural complex formation

    • Consider chaperone co-expression (GroEL/ES, DnaK/J/GrpE)

  • Limited Proteolysis:

    • Identify stable domains via limited proteolysis and mass spectrometry

    • Redesign constructs based on stable fragments

  • Protein Engineering:

    • Introduce surface mutations to enhance solubility

    • Remove exposed hydrophobic patches

    • Consider fusion to highly soluble protein partners

By methodically implementing this troubleshooting strategy, researchers can identify optimal conditions for obtaining soluble, stable, and functional recombinant FAM73A protein for downstream structural and functional studies .

How can I resolve discrepancies between in vitro and in vivo findings regarding FAM73A function?

When confronting discrepancies between in vitro and in vivo findings regarding FAM73A function, employ this systematic reconciliation framework:

Systematic Analysis of Discrepancies:

  • Comparative Mapping of Experimental Conditions:
    Create a detailed comparison table identifying key differences:

    AspectIn Vitro ConditionsIn Vivo ConditionsPotential Impact on Results
    MicroenvironmentHomogeneous media, defined nutrientsComplex tissue microenvironment, variable nutrientsMay affect mitochondrial dynamics and metabolic state
    Cell TypesIsolated cell populationsMultiple interacting cell typesCell-cell interactions may modulate FAM73A function
    DurationTypically short-term (hours-days)Long-term (days-months)Compensatory mechanisms may emerge over time
    OxygenationConsistent (usually atmospheric)Variable (tissue-dependent)Hypoxia alters mitochondrial function and morphology
    Cytokine MilieuDefined, simplifiedComplex, dynamicSignaling context affects FAM73A's impact
    Cell ActivationSingle stimulusMultiple, sequential stimuliMay explain different outcomes in complex systems
  • Technical Limitations Assessment:

    • Evaluate whether cell culture artifacts influence FAM73A function

    • Consider artificial substrate rigidity effects on mitochondrial dynamics

    • Assess whether non-physiological cell densities affect results

Bridging Experimental Approaches:

  • Ex Vivo Systems:

    • Analyze primary cells freshly isolated from FAM73A-deficient mice

    • Use tissue explants to maintain tissue architecture while allowing manipulation

    • Employ precision-cut tissue slices for short-term culture

  • 3D Culture Systems:

    • Implement organoid cultures from FAM73A wild-type and knockout tissues

    • Use co-culture systems with multiple cell types

    • Apply microfluidic devices to create more physiological conditions

  • In Vivo Cellular Imaging:

    • Utilize intravital microscopy to visualize mitochondrial dynamics in live animals

    • Apply FRET-based reporter systems to monitor FAM73A interactions in vivo

    • Consider cranial window approaches for longitudinal imaging

Reconciliation Strategies for Specific Discrepancies:

  • For Mitochondrial Morphology Discrepancies:

    • Compare mitochondrial network parameters in cultured cells versus tissue sections

    • Assess whether isolation procedures alter mitochondrial structure

    • Examine effects of tissue-specific metabolite concentrations on morphology

  • For Immune Activation Differences:

    • Compare cytokine production in isolated cells versus tissue microenvironments

    • Assess how complex immunological synapse formation affects outcomes

    • Evaluate contributions of tissue-resident versus circulating immune cells

  • For Anti-tumor Response Variations:

    • Implement patient-derived xenograft models to validate findings

    • Use syngeneic tumors in both immunocompetent and immunodeficient backgrounds

    • Assess tumor-intrinsic versus immune-mediated effects with bone marrow chimeras

Methodological Refinement Approach:

  • Progressive Complexity Gradient:

    • Begin with simple in vitro systems

    • Progress to co-cultures and 3D systems

    • Validate in diverse in vivo models

    • Cross-reference with human patient samples

  • Multi-parameter Analysis:

    • Implement simultaneous measurement of multiple outcomes

    • Apply single-cell technologies to capture heterogeneity

    • Use computational modeling to integrate diverse datasets

By systematically addressing these aspects, researchers can develop a more nuanced understanding of FAM73A function that reconciles apparent discrepancies between controlled in vitro systems and complex in vivo environments .

What are the most common pitfalls when analyzing the role of FAM73A in mitochondrial dynamics, and how can I avoid them?

When analyzing FAM73A's role in mitochondrial dynamics, researchers frequently encounter specific pitfalls that can compromise data interpretation. Here's a comprehensive guide to identifying and avoiding these challenges:

Technical Pitfalls in Imaging and Analysis:

  • Fixation Artifacts in Mitochondrial Morphology:

    • Pitfall: Fixation procedures can artificially fragment mitochondria

    • Solution: Compare multiple fixation protocols (paraformaldehyde concentrations, glutaraldehyde addition)

    • Best Practice: Include live-cell imaging controls alongside fixed samples

  • Observer Bias in Morphology Classification:

    • Pitfall: Subjective categorization of mitochondrial morphology

    • Solution: Implement automated image analysis algorithms

    • Validation Method: Use machine learning approaches for unbiased classification

  • Confounding Effects of Cell Confluence:

    • Pitfall: Cell density dramatically affects mitochondrial network

    • Solution: Standardize and report cell confluence in all experiments

    • Control Method: Create a density gradient experiment to determine optimal conditions

Experimental Design Challenges:

  • Knockout Compensation Mechanisms:

    • Pitfall: Long-term FAM73A knockout triggers compensatory changes

    • Solution: Use inducible knockout systems or acute protein depletion methods

    • Complementary Approach: Compare acute vs. chronic FAM73A deficiency effects

  • Overexpression Artifacts:

    • Pitfall: Non-physiological FAM73A levels create artificial phenotypes

    • Solution: Use endogenous tagging or regulated expression systems

    • Validation Strategy: Perform rescue experiments at near-endogenous levels

  • Context-Dependent Functions:

    • Pitfall: FAM73A's effects vary with cell type and stimulation state

    • Solution: Create a standardized testing matrix across cell types and conditions

    • Recommendation: Include the following condition table in every study:

    Cell TypeBaselineLPS-ActivatedIL-4-ActivatedHypoxiaNutrient Deprivation
    Macrophages[Data][Data][Data][Data][Data]
    Dendritic Cells[Data][Data][Data][Data][Data]
    Fibroblasts[Data][Data]N/A[Data][Data]
    Hepatocytes[Data]N/AN/A[Data][Data]

Mechanistic Investigation Limitations:

  • Fusion/Fission Balance Misinterpretation:

    • Pitfall: Static images cannot differentiate increased fusion from decreased fission

    • Solution: Perform time-lapse imaging with photoactivatable mitochondrial markers

    • Quantification Method: Calculate separate rates for fusion and fission events

  • Overlooking FAM73A-FAM73B Cooperation:

    • Pitfall: Studying FAM73A without considering FAM73B interaction

    • Solution: Always assess both proteins and their complex formation

    • Approach: Use double knockout controls and reconstitution experiments

  • Confounding Metabolic Effects:

    • Pitfall: Attributing all phenotypes directly to mitochondrial morphology

    • Solution: Measure metabolic parameters alongside morphological analysis

    • Control Experiments: Use metabolic inhibitors to distinguish primary from secondary effects

Data Interpretation Challenges:

  • Correlation vs. Causation Errors:

    • Pitfall: Assuming morphology changes directly cause functional outcomes

    • Solution: Perform rescue experiments with separation-of-function mutants

    • Approach: Create FAM73A variants that affect either morphology or signaling

  • Overlooking Tissue-Specific Differences:

    • Pitfall: Generalizing findings from one cell type to others

    • Solution: Validate key findings across multiple primary cell types

    • Recommendation: Include tissue-specific conditional knockout models

  • Threshold Effect Misinterpretation:

    • Pitfall: Binary interpretation of mitochondrial morphology changes

    • Solution: Quantify morphology as a continuous variable

    • Methodology: Report form factor, aspect ratio, and branching measurements

Advanced Methodological Solutions:

  • Implement Correlative Light and Electron Microscopy (CLEM):

    • Combines fluorescence imaging with ultrastructural EM analysis

    • Provides nanoscale resolution of mitochondrial connections

  • Use Optogenetic Approaches for Acute Manipulation:

    • Apply light-inducible protein interaction systems to manipulate FAM73A

    • Allows temporal control without genetic compensation

  • Employ Multi-omics Integration:

    • Combine mitochondrial morphology analysis with proteomics, metabolomics, and transcriptomics

    • Develop predictive models connecting morphology to function

By systematically addressing these common pitfalls, researchers can generate more reliable and reproducible data on FAM73A's role in mitochondrial dynamics and related cellular functions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.