Recombinant Mouse Protein GAPT (Gapt)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
Gapt; Protein GAPT; Growth factor receptor-bound protein 2-binding adapter protein, transmembrane
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-157
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Gapt
Target Protein Sequence
MLECFESSPVAVAVGVSLLVLLLLCGIGCAWHWNRRESTPFTLPKFMQRRSSRQKDVTKT VSSSAYVISPSMKASVESKGHKSTAKRNKMHGNYENVEVCPPCTEGTTEKALYENTQPSN LEEHVYGNQTDPLYYNFQKPSPPPPQDDDIYILPDCD
Uniprot No.

Target Background

Function

Recombinant Mouse Protein GAPT (Gapt) negatively regulates B-cell proliferation following B-cell receptor stimulation. It may play a crucial role in maintaining marginal zone (MZ) B-cells.

Database Links
Protein Families
GAPT family
Subcellular Location
Cell membrane; Single-pass membrane protein.
Tissue Specificity
Expressed primarily in B220+ splenocytes and total bone marrow cells. Expressed at lower levels in mast cells and dendritic cells. Not detected in T-cells and macrophages (at protein level).

Q&A

What is a recombinant mouse protein and how is it produced?

Recombinant mouse proteins are expressed using gene cloning technology, where mouse genes of interest are inserted into expression vectors and introduced into host cells (typically bacteria, yeast, or mammalian cell lines) for protein production. For example, mouse AgRP (Agouti-Related Protein) C-terminal fragment is commonly produced in E. coli expression systems, where the specific gene fragment encoding amino acids Ser82-Thr131 is cloned into an expression vector . The expression system choice depends on the protein's complexity, required post-translational modifications, and experimental needs. Following expression, the protein undergoes purification steps such as affinity chromatography to isolate the target protein from cellular components.

What are carrier-free recombinant proteins and when should they be used?

Carrier-free (CF) recombinant proteins are formulations that do not contain carrier proteins such as Bovine Serum Albumin (BSA). While carrier proteins enhance stability, increase shelf-life, and allow for more dilute storage concentrations of recombinant proteins, the carrier-free versions are specifically recommended for applications where the presence of BSA could interfere with experimental outcomes . For instance, receptor-binding assays, protein crystallization studies, and certain cell-based assays where background protein may affect results are cases where carrier-free formulations are preferred. Carrier-free proteins typically require more careful handling and storage conditions to maintain stability.

How should recombinant mouse proteins be stored and reconstituted?

Most lyophilized recombinant mouse proteins should be stored in a manual defrost freezer and protected from repeated freeze-thaw cycles to maintain biological activity . For reconstitution, specific protocols vary by protein but generally follow these guidelines:

Storage ParameterRecommended Condition
Before reconstitution-20°C to -80°C
Reconstitution solutionSterile PBS (typically at 100 μg/mL)
After reconstitutionWorking aliquots at -20°C, stock at -80°C
Shipping conditionAmbient temperature
AvoidRepeated freeze-thaw cycles

When working with recombinant proteins such as mouse AgRP, reconstitute at 100 μg/mL in sterile PBS and immediately store aliquots at recommended temperatures to preserve biological activity .

How do you design experiments to evaluate recombinant protein function in mouse models?

When evaluating recombinant protein function in mouse models, a comprehensive experimental design should include appropriate controls, dose determination, administration route selection, and endpoint measurements. For example, when evaluating recombinant proteins like LpxC and GmhA in mice, researchers included:

  • Control groups receiving adjuvant only, PBS, or inactivated whole bacteria

  • Experimental groups receiving purified recombinant proteins (typically 100 μg/100 μL)

  • Mixed protein groups to evaluate combinatorial effects

  • Challenge models to assess protective effects

  • Measurement of immune responses through antibody titers and cytokine profiles

The experimental timeline typically includes initial immunization, booster doses (often at 2-week intervals), sample collection points, and challenge experiments. Each experiment should have clear hypotheses, statistical power calculations, and appropriate animal ethics approvals.

What methods are used to verify protein expression and purification quality?

Verification of recombinant protein expression and purity involves multiple complementary techniques:

Verification MethodPurposeCommon Parameters
SDS-PAGESize verification and initial purity assessment10-15% gels, Coomassie or silver staining
Western BlotIdentity confirmationSpecific antibodies against target or tag
Affinity ChromatographyPurification based on His-tag or other fusion tagsNi-NTA for His-tagged proteins
Mass SpectrometryPrecise molecular weight determinationMALDI-TOF or ESI-MS
SpectrophotometryConcentration determinationA280 measurement, BCA/Bradford assays

As demonstrated with recombinant mouse proteins like LpxC and GmhA, purification typically involves affinity chromatography based on the His-tag, with verification of molecular weight (approximately 34 kD for LpxC and 21 kD for GmhA) by SDS-PAGE . The purity level required depends on the downstream application, with higher purity needed for structural studies than for immunization experiments.

How can you determine the effective dosage of recombinant proteins for in vitro and in vivo studies?

Determining effective dosage requires systematic dose-response experiments:

For in vitro studies:

  • Start with a broad concentration range (e.g., 0.001-10 μg/mL)

  • Measure biological response (e.g., receptor activation, cell proliferation)

  • Calculate ED50 (effective dose for 50% response)

  • For mouse AgRP C-terminal fragment, the typical ED50 is 0.025-0.15 μg/mL when measured for its antagonistic effect on alpha-MSH (10 ng/mL)

For in vivo studies:

  • Pilot experiments with 3-5 dose levels

  • Consider administration route (subcutaneous, intraperitoneal, etc.)

  • Monitor physiological responses and potential toxicity

  • For immunization studies with recombinant proteins, 50-100 μg per mouse is typically used

Effective dosing often depends on protein stability, target accessibility, and the biological system being studied. Document all dosing parameters carefully to ensure reproducibility.

How do recombinant proteins interact with their receptors and what methods are used to study these interactions?

Recombinant proteins interact with their receptors through specific binding domains that initiate downstream signaling cascades. For example, mouse AgRP acts as an antagonist for melanocortin receptors (MC-3 and MC-4), with its C-terminal region containing ten conserved cysteines that form five disulfide bonds critical for this interaction . These interactions can be studied through various methods:

  • Competitive binding assays: Measuring displacement of labeled ligands

  • Surface Plasmon Resonance (SPR): Real-time binding kinetics

  • Co-immunoprecipitation: Physical association in cellular contexts

  • FRET/BRET: Energy transfer between labeled protein pairs

  • Receptor internalization assays: Measuring β-arrestin-dependent endocytosis

AgRP is notably 100 times more potent than Agouti in antagonizing MC-3 and MC-4 receptors and induces β-arrestin-dependent endocytosis of these receptors . Understanding these molecular interactions is crucial for developing targeted therapeutic strategies and interpreting phenotypic effects in model systems.

What approaches are used to study the immune response to recombinant proteins in mouse models?

Comprehensive evaluation of immune responses to recombinant proteins includes:

Immune ParameterMeasurement MethodTypical Findings
Antibody responseELISA for IgG, IgM, IgA titersTemporal increase in antibody levels
T-cell responseCytokine profiling (IL-4, IL-10, IFN-γ)Th1/Th2 balance assessment
Cellular immunityFlow cytometry for immune cell populationsChanges in T-cell, B-cell, and APC proportions
Protection efficacyChallenge with pathogen or disease modelSurvival rate, symptom reduction

Research on recombinant proteins like GmhA has shown that they can stimulate both Th1 and Th2 immune responses, as evidenced by cytokine profiles including IL-4, IL-10, and IFN-γ, while other proteins like LpxC primarily induce Th2 responses . These differences in immune response profiles are critical when developing vaccines or immunotherapeutics and should be characterized thoroughly.

How are recombinant proteins used in structural biology studies?

Recombinant proteins play a crucial role in structural biology through:

  • X-ray crystallography: Requires highly purified, homogeneous protein samples (typically >95% purity) with concentrations of 5-20 mg/mL. The protein must maintain its native conformation and be stable in crystallization buffers.

  • NMR spectroscopy: Often requires isotopically labeled proteins (15N, 13C) produced in minimal media with specific nitrogen and carbon sources.

  • Cryo-electron microscopy: Particularly useful for larger protein complexes where crystallization is challenging.

  • Computational modeling: Uses protein sequence and available structural data to predict three-dimensional conformations and functional domains.

For example, the C-terminal region of mouse AgRP contains ten conserved cysteines forming five disulfide bonds that are critical for its biological activity . Structural studies have confirmed that this cysteine-rich region is sufficient for receptor interaction, providing insights into the molecular basis of AgRP's antagonistic effects on melanocortin receptors.

What are common issues in recombinant protein expression and how can they be resolved?

Researchers frequently encounter several challenges when expressing recombinant proteins:

IssuePotential CausesSolutions
Low expression levelsPoor codon optimization, toxic proteinOptimize codons for host, use inducible systems
Inclusion body formationRapid expression, improper foldingLower temperature, co-express chaperones
Protein degradationProteolytic activityAdd protease inhibitors, use protease-deficient hosts
Loss of activityImproper folding, missing co-factorsOptimize purification conditions, add co-factors
ContaminationInadequate purificationMultiple purification steps, endotoxin removal

For cysteine-rich proteins like mouse AgRP, proper disulfide bond formation is crucial for biological activity. Expression in E. coli may require specialized strains with oxidizing cytoplasm or refolding protocols . Addressing these issues often requires systematic optimization of expression conditions, host selection, and purification protocols.

How can researchers interpret contradictory findings about protein function across different experimental systems?

When faced with contradictory results about protein function, consider these methodological approaches:

  • Evaluate experimental contexts: Different cell types, tissue environments, or model organisms may yield different results due to varying co-factor availability or signaling pathway components.

  • Assess protein variants: C-terminal fragments versus full-length proteins may have different activities, as seen with AgRP where the C-terminal cysteine-rich region is sufficient for biological activity but may have different potency than the full protein .

  • Compare assay sensitivities: Different detection methods have varying sensitivities and dynamic ranges that might capture different aspects of protein function.

  • Consider post-translational modifications: Proteins produced in bacterial systems like E. coli lack eukaryotic modifications that might be essential for some functions.

  • Examine experimental controls: Validate key findings with both positive and negative controls, and consider dose-response relationships rather than single-dose experiments.

Systematic documentation of all experimental parameters and transparent reporting of conflicting results advances scientific understanding of complex protein functions.

What bioinformatic tools are available for analyzing recombinant protein function and interactions?

Modern bioinformatic tools provide valuable insights for recombinant protein research:

  • Sequence analysis platforms: Tools like BLAST, Clustal Omega, and HMMER for evolutionary conservation analysis and functional domain prediction.

  • Structural prediction software: AlphaFold, Rosetta, and I-TASSER for predicting three-dimensional structures based on amino acid sequences.

  • Protein-protein interaction databases: STRING, BioGRID, and specialized resources like GproteinDb (https://gproteindb.org) for G protein interactions .

  • Functional annotation tools: Gene Ontology (GO) analysis, KEGG pathway mapping, and Reactome for understanding protein functions in biological context.

  • Visualization platforms: PyMOL, Chimera, and VMD for visualizing protein structures and interaction interfaces.

For complex signaling proteins, specialized databases like GproteinDb provide comprehensive resources including "G protein coupling atlas, annotated structural templates, interface interactions and matching, and predicted selectivity determinants for mutagenesis" . These tools help translate structural and genomic data into insights about protein signaling networks crucial for human physiology and medicine.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.