Recombinant Mouse Protein GPR108 (Gpr108)

Shipped with Ice Packs
In Stock

Description

Role in AAV Transduction

GPR108 is essential for cellular entry of most AAV serotypes, except AAV5. Experimental findings include:

Table 1: GPR108 Dependency Across AAV Serotypes

AAV SerotypeGPR108 DependencyTransduction Efficiency in Gpr108 KO Cells
AAV2Yes10–100× reduction
AAV8Yes10–100× reduction
AAVrh32.33Yes10–100× reduction
AAV5NoNo change

Mechanistically, GPR108 facilitates endosomal escape and nuclear import of AAV genomes. In Gpr108 knockout (KO) murine models, AAV8 and rh32.33 showed 10- to 100-fold reduced transgene expression in vivo, while AAV5 remained unaffected .

3.1. Domain-Specific Requirements

  • N- and C-terminal domains: Both are necessary for AAV transduction. Chimeric studies demonstrated that replacing these domains with those of GPR107 (a homolog) abolished rescue functionality .

  • VP1 unique region: Determines GPR108 dependency. Transferring AAV5’s VP1u domain to AAV2 conferred GPR108 independence .

3.2. Cross-Species Functionality

  • Murine GPR108 rescued AAV transduction in human Huh7 cells, confirming functional conservation .

  • Avian cells (e.g., zebra finch), which lack endogenous GPR108, showed enhanced AAV2G9 transduction upon human GPR108 expression .

3.3. Subcellular Localization

  • Localizes to the TGN, where it interacts with viral particles during trafficking .

  • KO cells exhibit cytosolic accumulation of AAV genomes and reduced nuclear import .

Applications in Gene Therapy

  • Model systems: Gpr108 KO mice are used to study AAV tropism and optimize capsid designs .

  • Vector engineering: Modifying VP1u domains to evade GPR108 dependency could enhance tissue-specific targeting .

Experimental Protocols

Recombinant mouse GPR108 is typically used in:

  • Blocking assays: Pre-incubated with antibodies (e.g., PA5-66642) to validate specificity .

  • Rescue experiments: Expressed in KO cells to restore AAV transduction .

Future Directions

  • Investigating GPR108’s role in NF-κB signaling and immune responses to AAV .

  • Developing glycan-modified AAV capsids to bypass GPR108 requirements in refractory species .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C; lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Gpr108; Lustr2; Protein GPR108; Lung seven transmembrane receptor 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
35-569
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Gpr108
Target Protein Sequence
RIHRLTLTGEKRADIQLNSFGFYTNGSLEVELSLLRLSLQETEKKLPKVGFSLSRVRSGS VRSYSRRNSHECPLDRNSSNFLVLFLINIKDLQVQVRKYGEQKLFISPGLLPEAPTQSGP PKPDPAGTPKDNHVIHPSPTEMSAVKENQTAPQVSGDKTTPGEHRHSSERQPPTQDPSGK EKDQVLGLGHLNDSYNFSFHIVISSRAEEGQYSLNFHNCHNSIPGQEQPFDLTVMIREKN PEGFLSAAEIPLFKLYLIMSACFLAADIFWVSVLCKNTYSVFKIHWLMAALAFTKSVSLL FHSINYYFINSQGHPIEGLAVMHYITHLLKGALLFITIALIGSGWAFVKYMLSDKEKKIF GIVIPLQVLANVAYIVIESREEGASDYGLWKEILFLVDLICCGAILFPVVWSIRHLQDAS GTDGKVAVNLARLKLFRHYYVMVICYIYFTRIIAILLQVAVPFQWQWLYQLLVESSTLAF FVLTGYKFQPAGDNPYLQLPQEDEEDVQMEQVMTDSGFREGLSKVNKTASGRELL
Uniprot No.

Target Background

Gene References Into Functions
  1. The murine Gpr108 gene is located on chromosome 17C-D, spanning 12.8 kb. The Gpr108 cDNA encodes a 562-residue protein with 49% identity to human GPR107. [Gpr108 protein] PMID: 17454009
Database Links

KEGG: mmu:78308

UniGene: Mm.28468

Protein Families
LU7TM family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is GPR108 and what is its significance in virus research?

GPR108 is a member of the G protein-coupled receptor superfamily that functions as a critical entry factor for adeno-associated viruses (AAVs). It was identified through a genome-wide CRISPR screen specifically targeting the entry mechanisms of evolutionarily divergent serotype AAVrh32.33 . The significance of GPR108 in virus research is substantial as it represents only the second conserved AAV entry factor identified that maintains functionality across both mouse and human systems, both in vitro and in vivo .

GPR108 has structural similarity to GPR107, though they serve distinct functions in AAV entry. Unlike AAVR (the first identified AAV entry factor), GPR108 exhibits different serotype specificity patterns, creating a more complex picture of AAV cellular entry requirements. This discovery has important implications for AAV vector design and optimization in gene therapy applications, particularly when translating findings between animal models and human clinical applications .

How is GPR108 structurally organized and where is it localized in cells?

GPR108 is a transmembrane protein with distinct N-terminal and C-terminal domains that are both required for optimal AAV transduction. Immunofluorescence studies using FLAG-tagged GPR108 constructs have demonstrated that GPR108 primarily localizes to the trans-Golgi network (TGN), showing co-localization patterns with TGN46 marker protein . This Golgi localization is consistent with GPR108's proposed mode of action in viral entry pathways.

The protein appears to lack the furin cleavage site found in its homolog GPR107, as western blot analysis shows GPR108 migrating at the expected molecular weight of the full-length protein rather than producing cleaved fragments . Additionally, both mouse and human GPR108 exhibit higher molecular weight bands, suggesting they undergo post-translational modifications that may be important for function . The cellular localization to the TGN suggests GPR108 functions at a post-attachment step in the AAV entry process, likely involved in endosomal trafficking or escape.

What AAV serotypes depend on GPR108 for cellular entry?

Research has demonstrated that GPR108 dependency is remarkably broad across AAV serotypes, with a notable exception. In studies using GPR108 knockout cell lines, all tested serotypes (more than 20 divergent AAVs across all AAV clades) showed substantial reductions in transduction efficiency (10-100 fold decreases) except for AAV5 . This unique independence of AAV5 from GPR108 provides an important tool for understanding serotype-specific entry mechanisms.

Additionally, modified variants such as AAV9.PHP.B, which has enhanced ability to cross the blood-brain barrier, remain dependent on GPR108 despite their altered tropism, demonstrating that their unique targeting properties are not due to altered GPR108 usage . This serotype specificity pattern creates a clear distinction from the other known entry factor, AAVR, as some serotypes like AAV4 and rh32.33 are AAVR-independent but GPR108-dependent . This knowledge is critical for researchers selecting appropriate AAV serotypes for specific experimental or therapeutic applications.

How can researchers generate and validate GPR108 knockout cell lines?

To generate GPR108 knockout cell lines, researchers have successfully employed CRISPR-Cas9 genome editing. The process typically begins with the design of single guide RNAs (sgRNAs) targeting conserved exonic regions of the GPR108 gene. For validating successful GPR108 knockout, researchers should implement a multi-faceted approach:

  • Genomic validation through PCR amplification and sequencing of the targeted region to confirm editing

  • Protein-level validation using western blot with specific anti-GPR108 antibodies where available

  • Functional validation by testing AAV transduction efficiency, particularly with serotypes known to be GPR108-dependent (such as AAV8 or rh32.33) compared to GPR108-independent serotypes (AAV5)

When establishing GPR108 knockout lines, it's advisable to generate multiple independent clones to control for potential off-target effects. The functional validation approach is particularly valuable as it provides a clear phenotypic readout - GPR108 knockout cells should show significantly reduced transduction (10-100 fold) with most AAV serotypes except AAV5, which can serve as an internal control .

What rescue experiments validate GPR108 function in AAV entry?

Rescue experiments provide crucial validation of GPR108's specific role in AAV entry. The recommended methodological approach includes:

  • Transiently transfect GPR108 knockout cells with expression vectors containing FLAG-tagged human or mouse GPR108 cDNA

  • Include appropriate controls such as empty vector and the homologous protein GPR107 (which does not rescue AAV entry despite structural similarity)

  • Challenge the cells with various AAV serotypes carrying reporter genes (luciferase or GFP)

  • Quantify transduction efficiency through reporter gene expression

Successful rescue experiments demonstrate that exogenously expressed GPR108, but not GPR107, restores AAV transduction in knockout cells. Both human and mouse GPR108 have been shown to rescue function in human cell lines, demonstrating cross-species compatibility . This conservation is significant for translational research and suggests evolutionary conservation of this entry pathway. Additionally, stable re-introduction of GPR108 using lentiviral vectors has been shown to rescue AAV permissivity in multiple cell types, further validating GPR108's specific role .

How should researchers quantify AAV entry and transduction efficiency in GPR108 studies?

Accurate quantification of AAV entry and transduction is essential for GPR108 research. Multiple complementary methods should be employed:

  • Reporter Gene Assays: Using AAV vectors encoding luciferase or fluorescent proteins (GFP) allows for high-throughput quantification of successful transduction. Luciferase provides quantitative measurement of expression levels, while GFP enables flow cytometry analysis of transduction frequency .

  • Subcellular Fractionation: This method separates cellular components (cytoplasmic, membrane, nuclear fractions) followed by droplet digital PCR (ddPCR) to quantify viral genomes in each compartment. Clean separation should be validated using appropriate markers (e.g., tubulin for cytoplasm, AIF for membranes, histone H3 for nucleus) .

  • Binding Assays: Quantification of cell-bound viral genomes using qPCR helps distinguish between attachment defects and post-attachment entry defects. This is particularly valuable as research shows GPR108 acts downstream of attachment .

When performing these assays, it's critical to use non-saturating conditions (e.g., 10 GC/cell for 48 hours with Anc80 vectors) to enable detection of subtle differences in entry efficiency. Additionally, multiple AAV serotypes should be tested, with AAV5 serving as an important control due to its GPR108-independence .

How do GPR108's N-terminal and C-terminal domains contribute to AAV entry?

Research utilizing domain-swapping experiments between GPR108 and its non-functional homolog GPR107 has revealed critical insights into domain-specific contributions to AAV entry. Both the N-terminal and C-terminal domains of GPR108 are required for optimal AAV transduction, with intriguing patterns emerging from chimeric constructs:

  • Chimeras containing either the GPR108 N-terminal or C-terminal domain demonstrate partial rescue of AAV transduction

  • A chimera containing both GPR108 N- and C-terminal domains with GPR107 transmembrane domains rescues transduction to nearly wild-type levels

  • The chimera with GPR107 N- and C-terminal domains with the GPR108 transmembrane portion fails to rescue AAV entry

These findings suggest that the transmembrane domains of GPR107 and GPR108 are functionally interchangeable in the context of AAV entry, while the specific N- and C-terminal domains of GPR108 contain critical functional elements. Importantly, all chimeric constructs properly localize to the TGN, indicating that the observed functional differences are not due to mislocalization .

Researchers investigating domain functionality should note that protein expression levels do not correlate directly with rescue efficiency, suggesting that the specific functional properties of these domains, rather than abundance, determine AAV entry facilitation .

What is the relationship between the capsid VP1 unique domain and GPR108 dependency?

The VP1 unique domain (VP1u) plays a critical role in determining GPR108 dependency among AAV serotypes. Chimeric capsid studies between AAV2 (GPR108-dependent) and AAV5 (GPR108-independent) have revealed that:

  • AAV2 capsids containing the AAV5 VP1u region become GPR108-independent

  • This capsid determinant of GPR108 usage is transferable between serotypes

  • The effect is consistent across multiple cell types, including primary cells

These findings suggest a direct interaction or functional relationship between the VP1u region and GPR108 during the entry process. The VP1u region is known to be initially shielded within the capsid and becomes exposed during entry, consistent with GPR108's role in post-attachment steps.

For researchers designing AAV vectors with modified tropism or entry characteristics, engineering the VP1u region offers a potential strategy to modulate GPR108 dependency. This approach has been validated not only in cell culture but also in vivo, where chimeric vectors demonstrate predictable patterns of GPR108 dependency .

What are the mechanistic steps of GPR108-mediated AAV entry?

The current understanding of GPR108's role in AAV entry places it as a critical factor in post-attachment steps, specifically at or before nuclear import. Cell fractionation and mechanistic studies have revealed several key insights:

  • Cell binding assays show no difference in viral genome attachment between wild-type and GPR108 knockout cells, confirming GPR108 functions downstream of initial attachment

  • Subcellular fractionation analysis demonstrates:

    • In wild-type cells, 60-70% of viral genomes reach the nucleus

    • GPR108 knockout cells show decreased nuclear localization (52.2%)

    • Double knockout of GPR108 and AAVR further reduces nuclear localization (27%)

    • Increased membrane-associated genomes in knockout cells suggest a trafficking defect

  • GPR108's localization to the trans-Golgi network, combined with the functional data, suggests it facilitates endosomal escape or trafficking from TGN compartments to the nucleus

How does GPR108 knockout affect AAV transduction in mouse models?

The in vivo significance of GPR108 has been validated through studies with Gpr108 knockout mouse models. These studies reveal several important considerations for researchers:

  • Systemic administration of AAV vectors in Gpr108 knockout mice results in 10-100 fold reduced expression for multiple serotypes including AAV8 and rh32.33

  • Consistent with in vitro findings, AAV5 transduction remains unaffected in Gpr108 knockout mice

  • The magnitude of the in vivo effect confirms that alternative entry pathways do not efficiently compensate for GPR108 loss

These findings have significant implications for researchers using AAV vectors in mouse models, particularly when comparing results across different serotypes or when translating findings to potential clinical applications. The conservation of GPR108 dependency between in vitro and in vivo settings strengthens the biological relevance of this entry pathway.

For researchers designing in vivo experiments, the selection of appropriate AAV serotypes should consider GPR108 dependency patterns. When studying mechanisms that might affect GPR108 expression or function, AAV5 can serve as a valuable control serotype that should remain unaffected by these manipulations .

What implications does GPR108 have for cross-species application of AAV vectors?

The conservation of GPR108 function between mouse and human systems has important implications for translational research. Several key observations highlight this cross-species compatibility:

  • Mouse GPR108 effectively rescues AAV transduction when expressed in human GPR108 knockout cells

  • Human and mouse GPR108 show similar post-translational modification patterns

  • The conserved role of GPR108 provides mechanistic support for the predictive value of mouse models in AAV gene therapy development

This cross-species conservation is not universal among entry factors for viral vectors, making GPR108 particularly valuable for translational research. For researchers developing AAV-based gene therapies, this conservation suggests that GPR108-related entry mechanisms identified in mouse models are likely to translate to human applications.

When conducting preclinical studies, researchers should consider that differences in GPR108 expression patterns between tissues and species might contribute to differential tropism of AAV vectors. Integration of knowledge about GPR108 dependency with tissue-specific expression data could help predict and optimize vector performance across species .

How might GPR108 be exploited for optimizing AAV vectors for gene therapy?

Understanding GPR108's role in AAV entry opens several strategic approaches for optimizing gene therapy vectors:

  • Serotype Selection: For applications where target tissues might have variable GPR108 expression, choosing between GPR108-dependent or GPR108-independent serotypes could enhance specificity

  • Capsid Engineering: Modification of the VP1u region based on the AAV2/AAV5 chimera findings could create novel vectors with altered dependency on GPR108, potentially changing tropism or enhancing transduction in specific contexts

  • Combinatorial Targeting: Since different serotypes show varied dependencies on AAVR and GPR108, strategic engineering could create vectors that utilize alternative entry pathways in tissues where one receptor might be limiting

  • Pre-treatment Strategies: Temporary modulation of GPR108 expression or function in target tissues could potentially enhance vector delivery before administration

For researchers pursuing these strategies, it's important to note that capsid engineering approaches that alter GPR108 usage can be validated through in vitro rescue experiments in GPR108 knockout cells before advancing to more complex in vivo studies. The finding that AAV9.PHP.B remains GPR108-dependent despite its enhanced CNS tropism indicates that GPR108 usage can be maintained even when other targeting properties are modified .

What are the most significant unanswered questions about GPR108 in AAV research?

Despite substantial progress in understanding GPR108's role in AAV entry, several critical questions remain unresolved:

  • The precise molecular mechanism by which GPR108 facilitates AAV trafficking remains unclear - direct binding studies between GPR108 and AAV capsids would provide valuable insights

  • The specific structural features within the VP1u region that determine GPR108 dependency need further characterization through more detailed mutagenesis studies

  • Tissue-specific expression patterns of GPR108 across various organs and their correlation with AAV tropism warrant investigation

  • The potential role of GPR108 in the entry of other viruses or in normal cellular functions remains largely unexplored

  • The interplay between GPR108 and AAVR in different cellular contexts and how they might compensate for each other deserves deeper investigation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.