Recombinant Mouse Protein JTB (Jtb)

Shipped with Ice Packs
In Stock

Description

Primary Sequence and Domain Organization

The full-length mouse JTB protein spans residues 31–146 (Uniprot ID: O88824), with a sequence rich in cysteine residues and hydrophobic regions. Its N-terminal ectodomain adopts a β-meander fold resembling the midkine/pleiotrophin family, suggesting potential interactions with extracellular matrices or signaling molecules .

FeatureDetail
SequenceEAPVREEKLSVSTSTSPCWLAEEFVVTEECTPCSNFQIKTTPECGSTGYVEKITCSSSKRNEFKSCRSALLEQHLFWKFEGVVVAVALVFACLVIVRQRQLDRKALEKVRKQIESI
Domain StructureN-terminal cysteine-rich extracellular domain; transmembrane and cytoplasmic regions
Molecular Weight~16.4 kDa (predicted); ~34.7 kDa with tags (e.g., His-tag)

Expression and Tagging

Recombinant mouse JTB is produced in E. coli with an N-terminal 10xHis-tag for purification. This tag enables immobilized metal affinity chromatography (IMAC) and facilitates downstream applications like SDS-PAGE or protein interaction studies .

  • Formulation: Lyophilized powder in Tris/PBS-based buffer with 6% trehalose .

  • Stability: Repeated freeze-thaw cycles should be avoided to preserve activity .

Role in Cellular Pathways

While human JTB is extensively studied for its oncogenic potential, mouse JTB homologs are used to model its roles in:

  1. Mitotic Regulation: Part of the chromosomal passenger complex (CPC), ensuring accurate chromosome segregation during mitosis .

  2. Apoptosis Modulation: Overexpression may inhibit apoptosis induced by TGF-β1, contributing to cancer cell survival .

  3. Epithelial-Mesenchymal Transition (EMT): Dysregulation in EMT pathways, promoting metastasis in cancer models .

Experimental Utilities

  • SDS-PAGE: Used to confirm protein integrity and purity .

  • Proteomics: Studied in tandem with human JTB to identify dysregulated pathways (e.g., mitotic spindle assembly, oxidative stress) .

Comparative Analysis with Human JTB

FeatureMouse JTBHuman JTB
Uniprot IDO88824O76095
Molecular Weight~16.4 kDa~16.4 kDa
Expression HostE. coli (recombinant)HEK293 cells (recombinant)
Key Functional RolesMitotic regulation, apoptosisTumor progression, EMT, CPC activity

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Jtb; Gm622; Protein JTB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
31-146
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Jtb
Target Protein Sequence
EAPVREEKLSVSTSTSPCWLAEEFVVTEECTPCSNFQIKTTPECGSTGYVEKITCSSSKRNEFKSCRSALLEQHLFWKFEGVVVAVALVFACLVIVRQRQLDRKALEKVRKQIESI
Uniprot No.

Target Background

Function
Essential for normal cytokinesis during mitosis, this protein plays a regulatory role in cell proliferation. It may be a component of the chromosomal passenger complex (CPC), a crucial regulator of mitosis. The CPC complex is vital for centromere function in accurate chromosome alignment and segregation, and is necessary for chromatin-induced microtubule stabilization and spindle assembly. It enhances AURKB activity and inhibits TGFB1-induced apoptosis. Overexpression leads to mitochondrial swelling and reduced mitochondrial membrane potential.
Database Links

KEGG: mmu:23922

UniGene: Mm.13912

Protein Families
JTB family
Subcellular Location
Membrane; Single-pass type I membrane protein. Mitochondrion. Cytoplasm. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm, cytoskeleton, spindle.

Q&A

What is JTB protein and what is its significance in research?

JTB (Jumping Translocation Breakpoint) is a conserved protein involved in unbalanced chromosome translocations in various cancers. The mouse JTB protein shares structural and functional similarities with human JTB, which consists of approximately 146 amino acids with a molecular weight of approximately 16.4 kDa . JTB contains a signal sequence at the N-terminus, a cysteine-rich extracellular domain, a hydrophobic transmembrane domain, and a cytoplasmic domain .

This protein is significant in research due to its ubiquitous expression in normal tissues while showing dysregulated expression (either overexpressed or underexpressed) in various cancer types. Its involvement in cell proliferation, cytokinesis, and mitotic regulation makes it a valuable target for understanding fundamental cellular processes and disease mechanisms .

How conserved is mouse JTB compared to human JTB?

Mouse JTB shows significant homology to human JTB, making it a suitable model for investigating JTB functions that may translate to human biology. While the search results don't provide specific sequence homology percentages, the functional domains (signal sequence, cysteine-rich extracellular domain, transmembrane domain, and cytoplasmic domain) are conserved between species. When conducting mouse JTB studies with potential human applications, researchers should acknowledge both the similarities in structure and potential species-specific differences in interacting partners and regulatory mechanisms.

To validate your mouse model findings, consider:

  • Comparing expression patterns in equivalent mouse and human tissues

  • Confirming key protein interactions exist in both species

  • Validating phenotypic effects through complementary human cell line studies

What are the standard methods for producing recombinant mouse JTB protein?

Recombinant mouse JTB protein can be produced using several expression systems, with mammalian expression systems often preferred for maintaining proper post-translational modifications. Based on human JTB production methods, the following protocol can be adapted for mouse JTB:

  • Clone the mouse JTB coding sequence into an appropriate expression vector (e.g., CMV-driven with epitope tags such as HA, His, or Fc)

  • Transform/transfect the construct into the chosen expression system (HEK293 cells work well for mammalian expression)

  • Confirm expression by Western blotting

  • Purify using affinity chromatography based on the fusion tag

  • Verify purity by SDS-PAGE (aim for >85% purity)

  • Lyophilize from sterile PBS (pH 7.4) for long-term storage

For optimal stability, store lyophilized protein at -20°C to -80°C (stable for up to 12 months), and reconstituted protein at 4-8°C for short-term use (2-7 days) or aliquoted at -20°C for medium-term use (up to 3 months) .

What are the optimal conditions for studying JTB function in cellular assays?

When designing experiments to study mouse JTB protein function, consider the following methodological approaches:

  • Expression manipulation strategies:

    • Overexpression: Use sense orientation of mouse JTB cDNA in a tagged expression vector (HA, His, or FLAG tags are commonly used)

    • Knockdown: Employ shRNA targeting mouse JTB mRNA (consider using constructs with reporter genes like eGFP for tracking transfection efficiency)

    • Confirm altered expression levels by Western blotting before proceeding with functional assays

  • Cell systems:

    • Choose cell lines relevant to your research question (breast cancer, colon cancer, etc.)

    • Include appropriate controls (empty vector, scrambled shRNA)

    • Consider creating stable cell lines for long-term studies

  • Functional assays:

    • Proliferation: MTT/XTT assays, colony formation assays

    • Migration: Scratch/wound healing assays

    • Invasion: Transwell invasion assays

    • Apoptosis: Annexin V/PI staining, TUNEL assay

    • Mitotic regulation: Immunofluorescence for mitotic markers

  • Timing considerations:

    • Monitor effects at multiple time points (24h, 48h, 72h) to capture both immediate and delayed responses to JTB manipulation

How can I design proteomics experiments to identify JTB-interacting partners and affected pathways?

Based on successful proteomics approaches used with human JTB , consider the following methodology for mouse JTB:

  • Sample preparation:

    • Generate cells with manipulated JTB expression (overexpression and knockdown)

    • Include proper controls (empty vector or non-targeting shRNA)

    • Prepare cell lysates under conditions that preserve protein interactions

  • Complementary proteomics approaches:

    • In-gel digestion followed by nano LC-MS/MS (good for abundant proteins)

    • In-solution digestion (better for membrane proteins and provides higher sequence coverage)

    • Consider both approaches for a comprehensive analysis

  • Data analysis workflow:

    • Use appropriate software (e.g., Mascot, Scaffold) for protein identification

    • Perform quantitative comparison between experimental and control conditions

    • Identify differentially expressed proteins

    • Conduct pathway enrichment analysis using tools like Gene Set Enrichment Analysis (GSEA)

  • Validation experiments:

    • Confirm key findings by Western blotting

    • Perform co-immunoprecipitation for direct interaction partners

    • Use functional assays to validate pathway involvement

The table below outlines the advantages of complementary proteomics approaches:

ApproachAdvantagesBest For
In-gel digestionBetter for separating complex mixtures, visual confirmation of protein sizeAbundant proteins, targeted analysis
In-solution digestionHigher protein sequence coverage, better for membrane proteins, avoids gel fixation issuesHighly concentrated samples, integral membrane proteins
Combined approachComprehensive coverage, complementary identificationsComplete proteome analysis

What controls should be included when studying JTB in mouse cancer models?

When investigating JTB in mouse cancer models, include these essential controls:

  • Expression controls:

    • Empty vector controls for overexpression studies

    • Scrambled/non-targeting shRNA for knockdown studies

    • Isotype controls for antibody-based detection methods

  • Tissue-specific controls:

    • Compare tumor tissue with adjacent normal tissue

    • Include multiple normal tissue types to account for tissue-specific expression patterns

    • Consider developmental stage controls if relevant

  • Technical validation:

    • Use multiple antibodies targeting different epitopes when possible

    • Validate antibody specificity using knockout/knockdown samples

    • Employ both protein and mRNA detection methods (Western blot and qRT-PCR)

  • Biological validation:

    • Use multiple cell lines or primary cells to confirm findings

    • Consider using both in vitro and in vivo models

    • Compare results with human cancer data when applicable

How does JTB influence the epithelial-mesenchymal transition (EMT) in cancer progression?

JTB dysregulation significantly impacts EMT, a critical process in cancer invasion and metastasis. Based on human JTB studies, mouse JTB likely influences EMT through similar mechanisms:

  • Cytoskeletal reorganization:
    JTB dysregulation affects proteins involved in actin cytoskeleton organization, including tubulins (TUBB, TUBA1A) and actin-related proteins . These changes facilitate the cell shape modifications necessary for EMT.

  • Extracellular matrix remodeling:
    JTB overexpression affects collagen expression and ECM remodeling proteins , potentially enhancing invasion capabilities through altered cell-matrix interactions.

  • Proteostasis and EMT:
    JTB-related proteins involved in cellular proteostasis promote EMT by regulating protein quality control systems that are essential for cancer cell survival under stress conditions . These include components of:

    • Unfolded protein response (UPR)

    • Chaperone-mediated autophagy (CMA)

    • Selective degradation of misfolded proteins

  • Ribosome biogenesis and translation:
    JTB dysregulation affects ribosomal proteins (including RPS14, RPL6) that contribute to tumor-specific "onco-ribosomes" which facilitate the oncogenic translation program and metabolic reprogramming .

To study JTB's impact on EMT in mouse models, monitor these markers before and after JTB manipulation:

EMT CategoryEpithelial MarkersMesenchymal Markers
Cell AdhesionE-cadherin, Claudins, OccludinN-cadherin, Vimentin
Transcription Factors-Snail, Slug, ZEB1/2, Twist
ECM ComponentsLaminin, Collagen IVFibronectin, Collagen I, III, XI
CytoskeletalCytokeratinsVimentin, α-SMA

What is the role of JTB in mitotic regulation and chromosomal stability?

JTB plays crucial roles in mitotic regulation and chromosomal stability:

  • Chromosomal passenger complex (CPC) involvement:
    Human JTB appears to be a component of the chromosomal passenger complex, which regulates mitosis by ensuring correct chromosome alignment and segregation . When investigating mouse JTB's role in mitosis, examine:

    • Localization during different mitotic phases

    • Co-localization with known CPC components (Aurora B, INCENP, Survivin, Borealin)

    • Effects of JTB manipulation on mitotic progression

  • Spindle assembly regulation:
    JTB contributes to chromatin-induced microtubule stabilization and proper spindle assembly . Dysregulated JTB expression affects the MITOTIC_SPINDLE pathway , suggesting a direct role in maintaining spindle integrity.

  • Cytokinesis completion:
    JTB is required for normal cytokinesis during mitosis . Research methods to assess this function include:

    • Time-lapse microscopy to track cell division completion

    • Immunofluorescence to detect cytokinetic bridges and multinucleation

    • Flow cytometry to measure polyploidy resulting from failed cytokinesis

  • Genomic instability:
    JTB dysregulation promotes genomic instability , which can be assessed through:

    • Metaphase spread analysis for chromosomal abnormalities

    • Micronuclei formation assays

    • DNA damage marker (γH2AX) quantification

How can I analyze the relationship between JTB expression and metabolic reprogramming in cancer cells?

JTB dysregulation appears to influence metabolic pathways crucial for cancer progression. To investigate this relationship:

  • Target pathways for investigation:
    Based on human JTB studies, focus on these metabolic pathways affected by JTB expression:

    • Fatty acid metabolism (upregulated with JTB overexpression)

    • Oxidative phosphorylation (downregulated with JTB overexpression)

    • Glycolysis (downregulated with JTB knockdown)

    • Cholesterol homeostasis (downregulated with JTB knockdown)

  • Experimental approaches:

    • Metabolic flux analysis: Use isotope-labeled nutrients (13C-glucose, 13C-glutamine, 13C-palmitate) followed by mass spectrometry to track metabolite flow through pathways

    • Respirometry: Measure oxygen consumption rate (OCR) and extracellular acidification rate (ECAR) using Seahorse Analyzer to assess OXPHOS and glycolysis

    • Enzyme activity assays: Measure key metabolic enzymes that show altered expression with JTB dysregulation

    • Lipid profiling: Quantify changes in lipid species composition using lipidomics approaches

  • Key protein markers to monitor:
    Based on proteomics findings in human studies , these proteins show altered expression with JTB dysregulation:

PathwayProtein MarkersJTB Overexpression EffectJTB Knockdown Effect
Fatty Acid MetabolismFASNDownregulatedDownregulated
GlycolysisENO1, ENO2, GAPDH, PGK1, TPI1ENO2 upregulated, ENO1 & TPI1 downregulatedENO2, PGK1, GAPDH upregulated, TPI1 downregulated
OXPHOSSLC25A5UpregulatedNot specified
Stress ResponseSOD1, PRDX1, PRDX2DownregulatedPRDX2 upregulated, SOD1 downregulated
  • Integration with signaling pathways:
    Analyze how JTB-mediated metabolic changes correlate with:

    • Growth signaling pathways (mTOR, PI3K/AKT)

    • Hypoxia response (HIF1α targets)

    • Stress response pathways (oxidative stress markers)

What are common technical challenges in recombinant mouse JTB protein production and how can they be addressed?

When producing recombinant mouse JTB protein, researchers might encounter these challenges:

  • Protein solubility and aggregation:

    • Challenge: JTB contains a hydrophobic transmembrane domain that may cause aggregation

    • Solution: Consider producing only the extracellular domain or using detergents during purification

    • Alternative approach: Use fusion partners that enhance solubility (SUMO, thioredoxin, GST)

  • Low expression levels:

    • Challenge: Transmembrane proteins often express poorly in heterologous systems

    • Solution: Optimize codon usage for the expression host and use strong inducible promoters

    • Alternative approach: Test multiple expression systems (mammalian, insect, bacterial) to find optimal conditions

  • Proper folding and post-translational modifications:

    • Challenge: Ensuring proper disulfide bond formation in the cysteine-rich domain

    • Solution: Express in mammalian systems like HEK293 cells that provide appropriate folding environment

    • Validation method: Assess protein activity through functional assays

  • Purification difficulties:

    • Challenge: Purifying full-length protein with transmembrane domain

    • Solution: Use appropriate detergents during extraction and purification

    • Tag selection: C-terminal tags (like Fc) have been successful for human JTB and may work for mouse JTB

  • Storage stability:

    • Challenge: Maintaining protein stability during storage

    • Solution: Lyophilize from sterile PBS (pH 7.4) and store at -20°C to -80°C for up to 12 months

How can I validate the specificity of antibodies for mouse JTB in various applications?

Thorough antibody validation is crucial for reliable JTB detection:

  • Western blot validation:

    • Use positive controls (tissues/cells known to express JTB)

    • Include negative controls (JTB knockdown/knockout samples)

    • Verify band size matches predicted molecular weight (~16.4 kDa for untagged protein)

    • Test multiple antibodies targeting different epitopes

  • Immunohistochemistry/Immunofluorescence validation:

    • Compare staining pattern with published JTB localization data

    • Perform peptide competition assays to confirm specificity

    • Include isotype controls to assess non-specific binding

    • Validate subcellular localization with organelle markers

  • Cross-reactivity assessment:

    • Test antibody against human and mouse JTB to determine species specificity

    • Check for cross-reactivity with other JTB family members if applicable

  • Application-specific validation:

    • For ChIP applications: perform control IPs without antibody

    • For flow cytometry: use fluorescence-minus-one (FMO) controls

    • For proximity ligation assays: use single antibody controls

How can I interpret contradictory results in JTB functional studies?

JTB studies sometimes yield contradictory results, which may reflect context-dependent functions:

  • Cell type-specific effects:
    Human JTB can be overexpressed in some cancers and underexpressed in others . When facing contradictory results:

    • Compare the cell types used across studies

    • Assess baseline JTB expression levels before manipulation

    • Consider the cancer subtype and molecular classification

  • Technical considerations:

    • Overexpression artifacts: Very high expression may cause non-physiological effects

    • Knockdown efficiency: Partial vs. complete knockdown may yield different phenotypes

    • Timing differences: Acute vs. chronic JTB manipulation may have opposing effects

  • Pathway interconnections:
    JTB affects multiple pathways simultaneously. In human studies, JTB dysregulation showed:

    • Upregulation of tumor-promoting pathways (EMT, mitotic spindle, fatty acid metabolism)

    • Simultaneous downregulation of antitumor activities in some contexts

    This balance may shift depending on experimental conditions.

  • Systematic approach to resolve contradictions:

    • Replicate experiments under identical conditions

    • Vary one parameter at a time (cell density, serum concentration, etc.)

    • Use multiple methodological approaches to measure the same endpoint

    • Consider temporal dynamics by analyzing multiple time points

What is the role of JTB in normal physiological processes?

Beyond its implications in cancer, JTB plays important roles in normal cellular function:

  • Ubiquitous expression pattern:
    JTB is expressed in all normal human tissues studied , suggesting fundamental roles in cellular homeostasis. When investigating mouse JTB in normal physiology:

    • Compare expression levels across tissues

    • Examine developmental expression patterns

    • Identify cell types with particularly high or low expression

  • Mitotic regulation in normal cells:
    JTB is required for normal cytokinesis during mitosis and may be a component of the chromosomal passenger complex (CPC) . In normal cells, it helps ensure:

    • Proper chromosome alignment and segregation

    • Microtubule stabilization and spindle assembly

    • Completion of cytokinesis

  • Cell proliferation regulation:
    JTB plays a role in regulating normal cell proliferation . To study this function:

    • Compare proliferation rates in cells with normal vs. altered JTB levels

    • Analyze cell cycle distribution using flow cytometry

    • Examine expression of cell cycle regulators in response to JTB manipulation

  • Potential roles in stress response:
    Based on its involvement in cellular proteostasis pathways in cancer , JTB may participate in normal stress responses. Investigate:

    • Expression changes under various stress conditions (heat shock, oxidative stress)

    • Interaction with stress response proteins

    • Contribution to recovery after cellular stress

How can I study JTB's role in developmental processes using mouse models?

To investigate JTB's developmental functions:

  • Developmental expression profiling:

    • Perform qRT-PCR and immunohistochemistry across embryonic stages

    • Generate tissue-specific expression maps during organogenesis

    • Compare with developmental expression patterns of known interaction partners

  • Genetic models for developmental studies:

    • Constitutive knockout: May cause embryonic lethality if JTB is essential

    • Conditional knockout: Use tissue-specific or inducible Cre-loxP systems

    • Knockin reporters: Create JTB-GFP fusion to track expression patterns

    • Point mutations: Target specific functional domains to assess their importance

  • Developmental processes to examine:
    Based on JTB's known functions in cellular processes, focus on:

    • Cell division and proliferation in developing tissues

    • Tissue morphogenesis requiring proper cytoskeletal function

    • EMT-like processes during development (neural crest migration, gastrulation)

    • Stress responses during developmental milestones

  • Methodology for developmental phenotyping:

    • Whole-mount embryo staining for morphological assessment

    • Histological analysis of affected tissues

    • Lineage tracing to follow cell fate decisions

    • Transcriptomics at key developmental timepoints

What interspecies differences should I consider when translating mouse JTB findings to human applications?

When translating mouse JTB research to human applications, consider these potential differences:

  • Sequence and structural variations:
    While the functional domains of JTB are conserved across species, there may be differences in:

    • Exact protein length and molecular weight

    • Post-translational modification sites

    • Regulatory elements controlling expression

  • Protein interaction networks:

    • Some JTB interaction partners may be species-specific

    • Conserved interactions may have different binding affinities

    • Pathway connections may have evolved differently

  • Expression patterns:

    • Tissue-specific expression levels may vary between species

    • Developmental timing of expression may differ

    • Response to stimuli and stress conditions may be species-specific

  • Experimental validation approaches:
    When translating findings between species:

    • Confirm key interactions in both mouse and human systems

    • Validate expression patterns in equivalent tissues

    • Test functional effects in human cell lines

    • Consider xenograft models using human cells in mouse hosts

What emerging technologies could advance mouse JTB protein research?

Several cutting-edge technologies could significantly enhance JTB research:

  • CRISPR-based approaches:

    • CRISPRi/CRISPRa: For precise modulation of endogenous JTB expression

    • Base editing: For introducing specific mutations without double-strand breaks

    • CRISPR screens: To identify synthetic lethal interactions with JTB

  • Advanced proteomics methods:

    • Proximity labeling (BioID, APEX): To map JTB's proximal protein interaction network

    • Thermal proteome profiling: To identify proteins stabilized by JTB interaction

    • Cross-linking mass spectrometry: To capture transient or weak interactions

  • Spatial transcriptomics and proteomics:

    • Imaging mass cytometry: To visualize JTB expression in tissue context

    • Spatial transcriptomics: To map JTB mRNA expression with spatial resolution

    • In situ sequencing: To detect JTB transcripts in intact tissues

  • Single-cell approaches:

    • scRNA-seq: To identify cell populations with unique JTB expression patterns

    • scATAC-seq: To map chromatin accessibility at the JTB locus

    • Live-cell imaging: To track JTB dynamics in individual cells

How can systems biology approaches enhance our understanding of JTB's role in cellular networks?

Systems biology offers powerful frameworks for understanding JTB's complex functions:

  • Network analysis approaches:

    • Construct protein-protein interaction networks around JTB

    • Identify network motifs and regulatory hubs connected to JTB

    • Map JTB to cellular pathways using enrichment analysis

  • Multi-omics integration:

    • Combine proteomics data with transcriptomics to identify regulation mechanisms

    • Integrate metabolomics to connect JTB to metabolic alterations

    • Correlate epigenomic data with JTB expression patterns

  • Mathematical modeling:

    • Develop dynamic models of JTB-regulated pathways

    • Use Boolean networks to map logical relationships between JTB and other factors

    • Apply machine learning to predict outcomes of JTB perturbation

  • Evolutionary systems biology:

    • Compare JTB networks across species to identify conserved modules

    • Analyze how JTB interaction networks evolved

    • Identify selective pressures acting on JTB

What therapeutic implications does JTB research have for cancer and other diseases?

JTB research has several potential therapeutic applications:

  • JTB as a diagnostic/prognostic marker:

    • Develop antibodies for JTB detection in tissue samples

    • Correlate JTB expression levels with disease outcomes

    • Create diagnostic panels including JTB

  • Targeting JTB directly:

    • Design small molecule inhibitors of JTB function

    • Develop peptide antagonists of JTB interactions

    • Use antisense oligonucleotides or siRNAs to modulate JTB expression

  • Targeting JTB-dependent vulnerabilities:

    • Identify synthetic lethal interactions with JTB dysregulation

    • Target downstream effectors in JTB-regulated pathways

    • Exploit metabolic dependencies created by JTB alterations

  • Therapeutic considerations:

    • Context-dependent functions may require personalized approaches

    • Potential for combination therapies targeting multiple aspects of JTB function

    • Biomarker development to identify patients likely to respond to JTB-targeted interventions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.