Recombinant Mouse Protein lifeguard 1 (Grina)

Shipped with Ice Packs
In Stock

Description

Introduction and Background

Protein lifeguard 1 (Grina) is a glutamate receptor-associated protein that belongs to the BI1 family, specifically the Lifeguard (LFG) subfamily . It is also known as Glutamate [N-Methyl-D-Aspartate] receptor-associated protein 1 or NMDA receptor glutamate-binding subunit . First identified in relation to NMDA receptors, Grina has since been recognized as part of the transmembrane BAX inhibitor motif (TMBIM) family of proteins, which are involved in regulating cell death and survival .

The protein was initially cloned in 1991 when researchers were investigating glutamate receptors. Initially, there was confusion about its role, as the protein exhibited seven transmembrane α-helices and lacked homology with other glutamate receptors . Later research clarified its structure and function, revealing its importance in calcium homeostasis and neuroprotection rather than as a direct component of NMDA receptors .

Grina is of particular interest because several studies have demonstrated its highly potent protective effect, preventing mice from cerebral ischemia-induced cell death and post-ischemic unfolded protein response . This protective capability makes it a valuable subject for research on neurological disorders and potential therapeutic interventions.

Gene Structure and Protein Expression

The mouse Grina gene encodes a 345 amino acid protein with a UniProt ID of Q9ESF4 . Human GRINA is located at chromosome region 8q24.3, near the subtelomere, and encodes a slightly larger 371 amino acid protein with a predicted molecular weight of 41.2 kDa . The mouse variant shows high homology with the human version, maintaining the essential functional domains.

Protein Domains and Structure

Protein domain prediction has revealed that Grina contains two major domains :

  1. A Proline-rich domain (fragment 39-139) within the N-terminal tail

  2. An LFG-like domain (fragment 151-367), belonging to the BI-1-like superfamily, across the transmembrane region

The protein's structure includes seven transmembrane α-helices in its central part, which is characteristic of the TMBIM family . Interestingly, the cytoplasmic N-terminal half of GRINA contains a potential DNA-binding sequence, in addition to cleavage target sites and probable PY-nuclear localization sequences . This suggests that under certain conditions, this portion may be released from the rest of the protein and enter the nucleus, potentially participating in transcription, alternative splicing, and mRNA export of genes involved in lipid and sterol synthesis, ribosome biogenesis, or cell cycle progression .

Tissue Distribution

Grina demonstrates a broad expression pattern in mammals. High levels are found in the central nervous system, particularly in the hippocampus, cerebellum, basal ganglia, cortex, and hindbrain . Significant expression is also observed in other organs such as the kidneys and testes .

Subcellular Localization

At the subcellular level, Grina is primarily a membrane protein with multiple transmembrane passes . It is found in several cellular compartments including :

  • Golgi apparatus

  • Endoplasmic reticulum

  • Plasma membrane

This distribution across multiple membrane-bound organelles aligns with its functions in calcium homeostasis and cell death regulation, as these processes require coordination between different cellular compartments.

Role in Calcium Homeostasis

One of the primary functions of Grina is its involvement in calcium homeostasis, particularly in endoplasmic reticulum calcium ion homeostasis . This is crucial for numerous cellular processes, including cell signaling, protein folding, and cell survival mechanisms. Dysregulation of calcium homeostasis can lead to various pathological conditions, especially in excitable cells like neurons.

Anti-apoptotic Properties

Grina functions as a potential apoptotic regulator . As a member of the TMBIM family, it plays a role in protecting cells from stress-induced apoptosis. Specifically, it has been shown to have a highly potent protective effect against cerebral ischemia-induced cell death and post-ischemic unfolded protein response (UPR) .

Modulation of Calcium Channels

Research has demonstrated that Grina/TMBIM3 modulates voltage-gated CaV2.2 Ca2+ channels in a G-protein-like manner . This function could have significant implications for neuronal signaling and synaptic transmission, as calcium channels play a critical role in neurotransmitter release and synaptic plasticity.

Table 2: Functional Roles of Recombinant Mouse Protein lifeguard 1 (Grina)

FunctionDescriptionReference
Calcium HomeostasisInvolved in endoplasmic reticulum calcium ion regulation
Anti-apoptotic RegulationActs as a potential apoptotic regulator
NeuroprotectionPrevents cerebral ischemia-induced cell death
Stress ResponseProtects against post-ischemic unfolded protein response
Ion Channel ModulationModulates voltage-gated CaV2.2 Ca2+ channels

Neurological Functions

Grina contributes significantly to neuroprotection, synaptic transmission, and plasticity due to its two conserved domains (Pro-rich domain and LFG-like domain) . In the central nervous system, Grina plays a crucial role in neuronal function and synaptic plasticity . Its involvement in calcium homeostasis is particularly important in neurons, where calcium signaling governs various aspects of neuronal development, function, and survival.

Neuroprotective Effects

Studies have shown that Grina has neuroprotective effects in models of central nervous system injury. It prevents mice from cerebral ischemia-induced cell death, suggesting a potential role in stroke protection . This protective function may be related to its ability to regulate calcium homeostasis and modulate the unfolded protein response during cellular stress.

Expression Systems

Recombinant Mouse Protein lifeguard 1 is typically produced using bacterial expression systems such as Escherichia coli, which allow for efficient protein production . The recombinant protein may include a tag (such as His-tag) to facilitate purification, with the tag type determined during the production process .

ELISA-Based Detection

Mouse Protein lifeguard 1 (Grina) ELISA kits are valuable tools for researchers seeking to accurately measure levels of Grina in mouse serum, plasma, and cell culture supernatants . These kits offer exceptional sensitivity and specificity, ensuring precise and reliable results for various research applications.

The typical specifications of such ELISA kits include :

  • Detection range: 31.2-2000 pg/mL

  • Sensitivity: 15.72 pg/mL

  • Suitable for detecting Grina in serum, plasma, tissue homogenates, cell culture supernatants, and other biological fluids

Antibody-Based Research

Anti-Protein lifeguard 1 GRINA antibodies are available for research applications such as ELISA and Western blotting . These antibodies can be used to study the expression and localization of Grina in various tissues and under different experimental conditions.

Functional Studies

Recombinant Mouse Protein lifeguard 1 can be used in functional studies to investigate its roles in:

  • Calcium homeostasis

  • Apoptotic regulation

  • Neuroprotection in models of neurological diseases

  • Studies of ion channel modulation

Neurological Disorders

Dysregulation of Grina has been linked to several neurological disorders, making it a valuable biomarker for investigating these conditions and potential therapeutic interventions . Specifically, Grina dysfunction has been implicated in:

  • Alzheimer's disease: Recent observations indicate a decreased cancer risk in patients with Alzheimer's disease, and Grina modulates aerobic glycolysis and promotes tumor progression in gastric cancer. This suggests that Grina may play a crucial role in Alzheimer's disease pathology .

  • Parkinson's disease: Studies have investigated the role of Grina in models of Parkinson's disease. While Faim2 (another Lifeguard family protein) deficiency aggravated neurodegeneration in the MPTP mouse model of Parkinson's disease, Grina deficiency did not show the same effect, possibly because Faim2 compensates for loss of Grina in mouse midbrain .

  • Schizophrenia: Upregulation of Grina has been reported in schizophrenia . Furthermore, about one-third of people with schizophrenia have elevated IgG antibodies to gliadin (AGA IgG), and research has shown that GRINA IgG was higher in schizophrenia patients than in healthy controls .

Role in Cerebral Ischemia

Grina demonstrates neuroprotective functions in cerebral ischemia and post-ischemic unfolded protein response . This suggests potential applications in stroke research and therapy development.

Table 4: Pathological Implications of Grina Dysregulation

DisorderGrina InvolvementReference
Alzheimer's DiseasePotential role in pathology, possibly related to metabolism
Parkinson's DiseaseStudied in MPTP model, no aggravation with Grina deficiency
SchizophreniaUpregulation observed, elevated Grina IgG in patients
DepressionUpregulation reported
Cerebral IschemiaNeuroprotective function
EpilepsyDysregulation linked to condition

Product Specs

Form
Lyophilized powder
Please note that we will preferentially ship the format we have in stock. However, if you have a specific format requirement, kindly indicate it in your order remarks. We will then prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery time information.
Our standard shipping method for all proteins includes normal blue ice packs. Should you require dry ice shipping, please communicate with us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing of the product is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
It is advisable to briefly centrifuge the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotation for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50% and can be used as a reference.
Shelf Life
The shelf life of the product is dependent on various factors including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store the product at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you require a specific tag type, please inform us and we will prioritize development of the specified tag.
Synonyms
Grina; Lag; Lfg1; Nmdara1; Protein lifeguard 1; Glutamate [NMDA] receptor-associated protein 1; NMDA receptor glutamate-binding subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-345
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Grina
Target Protein Sequence
MSHEKSFLVSGDSYPPQNIVGPQAPMPPYVQAPYPGAPYPQAPFQPSPYGQPGYPHGPSP YPQGGYPQGPYPQGGYPQGPYPQSPFPPNPYGQPPPFQDPGSPQHGNYQEEGPPSYYDNQ DFPAVNWDKNIRQAFIRKVFLVLTLQLSVTLSTVAIFTFVGEVKGFVRENVWTYYVSYAI FFISLIVLSCCGDFRRKHPWNLVALSILTVSLSYMVGMIASFYNTEAVIMAVGITTAVCF TVVIFSMQTRYDFTSCMGVLLVSVVVLFIFAILCIFIRNRILEIVYASLGALLFTCFLAV DTQLLLGNKQLSLSPEEYVFAALNLYTDIINIFLYILTIIGRAKE
Uniprot No.

Target Background

Function
Potential apoptotic regulator.
Gene References Into Functions
  1. This study demonstrates that TMBIM3 is expressed in the brain, with particularly high levels observed in the hippocampus. PMID: 21614515
Database Links
Protein Families
BI1 family, LFG subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What detection methods are available for measuring Mouse GRINA in experimental samples?

Multiple analytical approaches can be employed for GRINA detection:

Antibody-based methods:

  • Western Blotting (WB): Anti-GRINA antibodies like A11283 can detect the protein with expected band at 68 kDa

  • ELISA: Sandwich ELISA kits are available with detection ranges of 31.2-2000 pg/mL and sensitivity of approximately 15.72 pg/mL

mRNA expression analysis:

  • qRT-PCR using specific primers for GRINA/Lfg1/Nmdara1

Methodological considerations:

  • For ELISA applications, sample types can include serum, plasma, tissue homogenates, and cell culture supernatants

  • For optimal results in Western blotting, GRINA antibodies can be stored at 4°C for three months or at -20°C for up to one year

  • Sandwich ELISA methodology involves pre-coating antibodies onto a 96-well plate, followed by sample addition, incubation with biotin-conjugated reagent, and detection using HRP-conjugated reagent

What are the key functions of GRINA in cellular physiology?

GRINA serves multiple important functions in cellular physiology:

Calcium homeostasis regulation:

  • GRINA is predominantly located at the ER membrane where it suppresses ER calcium release via inositol-1,4,5-trisphosphate receptors

  • It maintains cytosolic Ca²⁺ concentration at low levels (around 100 nM) compared to ER and Golgi apparatus (3-5 thousand fold higher)

Anti-apoptotic regulation:

  • Functions as a potential apoptotic regulator

  • Participates in suppressing intrinsic apoptosis pathways by regulating cytosolic Ca²⁺ concentration during ER stress

Neuronal function:

  • Plays a crucial role in neuronal function and synaptic plasticity

  • Was initially identified as part of an NMDA receptor-like complex formed by 4 subunits

Unfolded Protein Response (UPR):

  • Involved in the endoplasmic reticulum stress response pathway

  • Contributes to the post-ischemic unfolded protein response

How should recombinant Mouse GRINA protein be stored and handled for optimal stability?

For optimal stability and activity of recombinant Mouse GRINA protein:

Storage conditions:

  • Store lyophilized protein at -20°C for long-term storage

  • After reconstitution, store at 4°C for short-term use (up to a week) or aliquot and store at -20°C

  • Avoid repeated freeze-thaw cycles to maintain protein integrity

Reconstitution procedure:

  • Reconstitute lyophilized protein in sterile PBS

  • For extended storage, addition of at least 0.1% carrier protein (such as BSA) is recommended

  • Gentle mixing after reconstitution is advised, as the protein may appear as a film at the bottom of the vial

Handling considerations:

  • For experimental applications, consider using carrier-free preparations when the presence of BSA could interfere with downstream applications

  • For cell culture applications or as ELISA standards, protein with carrier is generally recommended

What are the mechanisms by which GRINA regulates calcium homeostasis and cell death pathways?

GRINA employs several sophisticated mechanisms to regulate calcium homeostasis and cell death:

Calcium regulation models:
Three models have been proposed to explain how TMBIM proteins like GRINA arbitrate Ca²⁺ levels:

  • Channel formation: GRINA may form calcium channels that facilitate Ca²⁺ leakage

  • Indirect regulation: GRINA may interact with and modulate existing Ca²⁺ channels

  • pH-dependent regulation: GRINA may respond to pH changes by altering Ca²⁺ flux

Cell death pathway interactions:

  • While FAIM2 (another TMBIM family member) potentiates the activation of caspase 8, GRINA deficiency leads to strong activation of caspase 9

  • This suggests GRINA regulates the intrinsic (mitochondrial) apoptotic pathway, whereas FAIM2 regulates the extrinsic pathway

Synergistic effects:

  • Studies with double-deficient mice (Grina⁻/⁻Faim2⁻/⁻) revealed the highest neurological deficits and largest infarct sizes after stroke

  • This indicates complementary but distinct roles for these TMBIM proteins in neuroprotection

How does GRINA function in the context of cerebral ischemia and neuroprotection?

GRINA plays critical roles during cerebral ischemia and offers neuroprotective effects through several mechanisms:

Ischemic response:

  • GRINA deficiency (Grina⁻/⁻) leads to increased infarct volumes similar to Faim2⁻/⁻ mice following transient middle cerebral artery occlusion (tMCAO)

  • The combined absence of both GRINA and FAIM2 produces the most severe neurological deficits, suggesting complementary protective functions

Erythropoietin (EPO) regulation:

  • EPO administration upregulates both Grina and Faim2 mRNA levels in wildtype mice

  • EPO significantly decreases infarct sizes and abrogates neurological impairments in wildtype mice but not in GRINA-deficient mice

  • This indicates GRINA is a critical mediator of EPO's neuroprotective effects

Unfolded Protein Response (UPR) interaction:

  • Cerebral ischemia causes accumulation of misfolded proteins and disruption of calcium homeostasis, leading to ER stress

  • GRINA influences the post-ischemic UPR, particularly through the IRE1α and PERK branches

  • EPO treatment affects Grina mRNA levels after oxygen-glucose deprivation (OGD), suggesting a regulatory relationship

Experimental evidence table:

Experimental ModelGRINA StatusOutcomeMechanism
tMCAO in miceGrina⁻/⁻Increased infarct volumesEnhanced caspase 9 activation
tMCAO + EPO treatmentWildtypeDecreased infarct sizeUpregulation of Grina and Faim2 mRNA
tMCAO + EPO treatmentGrina⁻/⁻No significant protectionLoss of EPO-mediated neuroprotection
OGD in primary neuronsGrina⁻/⁻Impaired ischemia toleranceDisrupted calcium homeostasis
OGD + Grina overexpressionWildtypeDecreased cell death ratesEnhanced cell survival mechanisms

What nuclear functions have been identified for GRINA, and how might they be investigated?

Recent research has identified potential nuclear functions for GRINA that extend beyond its membrane-associated roles:

Nuclear localization and DNA-binding:

  • The cytoplasmic N-terminal half of GRINA contains a potential DNA-binding sequence

  • This region also contains cleavage target sites and probable PY-nuclear localization sequences

  • Under specific conditions, this domain may be released from the rest of the protein and enter the nucleus

Potential nuclear functions:

  • Participation in transcription regulation

  • Involvement in alternative splicing processes

  • Facilitation of mRNA export for specific gene subsets

  • Likely involvement in genes related to lipid/sterol synthesis, ribosome biogenesis, and cell cycle progression

Investigative approaches:

  • Subcellular fractionation followed by immunoblotting to detect GRINA fragments in nuclear fractions

  • Chromatin immunoprecipitation (ChIP) to identify DNA binding sites

  • RNA immunoprecipitation to detect RNA-protein interactions

  • Proximity ligation assays to identify nuclear protein interaction partners

  • Creation of domain-specific mutants to analyze which regions are required for nuclear localization

What methodological considerations should be addressed when using knockout models to study GRINA function?

When designing and interpreting experiments using GRINA knockout models, researchers should consider several important factors:

Model generation concerns:

  • Complete vs. conditional knockouts: Consider whether complete GRINA deletion affects development, potentially confounding adult phenotypes

  • Background strain effects: Genetic background can significantly influence phenotype expression in Grina⁻/⁻ mice

  • Compensatory mechanisms: Other TMBIM family members may be upregulated in GRINA knockouts

Experimental design factors:

  • Mortality rates: Some Grina⁻/⁻ mice died during or shortly after surgical procedures, suggesting increased vulnerability that must be accounted for in study design

  • Exclusion criteria: Studies have reported excluding some Grina⁻/⁻ mice due to extensive weight loss, which may introduce selection bias

Analytical considerations:

  • Caspase activation patterns: Grina⁻/⁻ mice show strong activation of caspase 9 (intrinsic pathway), contrasting with Faim2⁻/⁻ mice (caspase 8, extrinsic pathway)

  • Cell-type specific effects: Effects of GRINA deficiency may vary across cell types and tissues

  • UPR branch activation: Both the IRE1α and PERK branches of the UPR are differentially affected in Grina⁻/⁻ mice

Validation approaches:

  • Reintroduction experiments: Overexpression of Grina in knockout neurons can confirm phenotype rescue

  • Combined knockouts: Double-deficient models (Grina⁻/⁻Faim2⁻/⁻) provide insights into complementary or redundant functions

What protein-protein interaction studies have been conducted with GRINA, and how might recombinant GRINA facilitate further interactome analysis?

Investigating GRINA's protein-protein interactions provides critical insights into its function:

Current interaction data:

  • GRINA's interactome suggests roles beyond calcium regulation

  • Preliminary data indicates interactions with proteins involved in endosome-to-Golgi retrieval pathways

  • The N-terminal Proline-rich domain may serve as a hub for protein interactions

Methodological approaches for interactome studies:

  • Affinity purification coupled with mass spectrometry:

    • Using recombinant tagged GRINA as bait

    • Domain-specific constructs to identify domain-specific interactions

  • Proximity labeling approaches:

    • BioID or APEX2 fusion proteins to identify proximal interactors in living cells

    • Allows detection of transient or weak interactions

  • Yeast two-hybrid screening:

    • Using domain-specific constructs as bait

    • Helps identify direct protein-protein interactions

  • Co-immunoprecipitation validation:

    • Using anti-GRINA antibodies like A11283

    • Confirming putative interactions identified by high-throughput methods

Applications of recombinant GRINA:

  • Domain-specific recombinant fragments can determine which regions mediate specific interactions

  • In vitro binding assays with purified proteins can establish direct interactions

  • Surface plasmon resonance or isothermal titration calorimetry using recombinant GRINA can determine binding affinities and kinetics

How can contradictions in GRINA functional studies be resolved through improved experimental design?

Resolving inconsistencies in GRINA research requires careful consideration of:

Source of contradictions:

  • Historical misidentification: GRINA was initially misidentified as a glutamate-binding subunit of NMDA receptors before being recognized as a TMBIM family member

  • Observed vs. calculated molecular weight discrepancy: GRINA has a calculated MW of ~41 kDa but is observed at ~68 kDa, suggesting significant post-translational modifications that may affect function

Enhanced experimental approaches:

  • Protein expression system selection:

    • Yeast expression systems (like Pichia pastoris) provide natural folding and post-translational modifications

    • These are superior to E. coli systems for studying functionally authentic GRINA

  • Cell-type specific analysis:

    • Different cell types may utilize GRINA in different pathways

    • Primary neurons, astrocytes, and microglia should be separately analyzed

  • Integration of multiple analytical techniques:

    • Combine protein-level (Western blot, immunoprecipitation) with mRNA-level analyses

    • Correlate with functional assays (calcium imaging, apoptosis assays)

  • Context-dependent studies:

    • Analyze GRINA function under specific stressors (ER stress, calcium dysregulation)

    • Compare normal vs. pathological conditions

Methodological standardization:

  • Standardized reporting of expression systems for recombinant proteins

  • Consistent use of antibodies with validated specificity

  • Clear distinction between observations in different model systems

  • Integration of both gain-of-function and loss-of-function approaches

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.