Recombinant Mouse Protein lifeguard 2 (Faim2)

Shipped with Ice Packs
In Stock

Description

Neuroprotection in Cerebral Ischemia

  • Model: Transient middle cerebral artery occlusion in mice.

  • Results:

    • Faim2-deficient mice exhibited 40% larger infarcts and elevated caspase-3 activity compared to wild types .

    • Lentiviral Faim2 overexpression reduced infarct size by 32% in wild-type mice and rescued apoptosis in knockouts .

  • Mechanism: Downregulation of Faim2 post-ischemia permits Fas-mediated regeneration, while early upregulation limits apoptosis .

Retinal Photoreceptor Survival

  • Model: Retinal detachment in wild-type and Faim2 −/− mice.

  • Results:

    • Faim2 −/− mice showed 2.5× higher TUNEL-positive photoreceptors at 3 days post-detachment .

    • Faim2 interacts with HSP90 and p53 to delay Fas-mediated apoptosis under stress .

  • Therapeutic Insight: Proteasome inhibition stabilizes Faim2, suggesting pharmacological strategies to enhance its neuroprotective effects .

Cardiac Hypertrophy Regulation

  • Model: Transverse aortic constriction (TAC) in Faim2 −/− mice.

  • Results:

    • Faim2 deficiency exacerbated TAC-induced cardiac hypertrophy, increasing heart weight/body weight ratios by 25% .

    • Overexpression in neonatal rat ventricular myocytes reduced phenylephrine-induced Bnp expression by 60% .

Cancer and Immune Microenvironment

  • Pan-Cancer Analysis:

    • Low Faim2 expression correlates with poor prognosis in glioma (HR = 0.67, p < 0.001) and increased myeloid-derived suppressor cell infiltration .

    • Acts as a tumor suppressor by enhancing CD8+ T-cell activity in BRCA, LUSC, and SKCM models .

Genetic and Therapeutic Implications

  • Obesity Link: GWAS identified FAIM2 SNPs (e.g., rs7132908) associated with childhood obesity risk (OR = 1.18, p = 4.2×10⁻⁸) .

  • Therapeutic Challenges: Timing-dependent effects—early Faim2 upregulation prevents apoptosis, while late inhibition may enhance regeneration .

Future Directions

  • Mechanistic Studies: Resolve structural interactions between Faim2 and Fas trimerization domains .

  • Clinical Translation: Develop small-molecule stabilizers to prolong Faim2 activity in acute neuronal injury .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please specify it, and we will prioritize its use.
Synonyms
Faim2; Kiaa0950; Lfg; Lfg2; Nmp35; Protein lifeguard 2; Fas apoptotic inhibitory molecule 2; Neural membrane protein 35
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Faim2
Target Protein Sequence
MTQGKLSVANKAPGTEGQQHQANGEKKDAPAVPSAPPSYEEATSGEGLKAGTFPQGPTAV PLHPSWAYVDPSGSSGYEGGFPAGHHEHFTTFSWDDQKVRRLFIRKVYTILLVQLLVTLA VVALFTFCDVVKDYVQANPGWYWASYAVFFATYLTLACCSGPRRHFPWNLILLTIFTLSM AYLTGMLSSYYNTTSVLLCLVITALVCLSVTIFSFQTKFDFTSCQGVLFVLLMTLFFSGL LLAVLLPFQYVPWLHAVYAVLGAGVFTLFLAFDTQLLMGNRRHSLSPEEYIFGALNIYLD IIYIFTFFLQLFGTNRE
Uniprot No.

Target Background

Function
FAIM2 (Lifeguard 2) is an antiapoptotic protein uniquely protecting cells from Fas-induced apoptosis. It regulates Fas-mediated apoptosis in neurons by inhibiting caspase-8 activation. FAIM2 also plays a crucial role in cerebellar development, influencing cerebellar size, internal granular layer (IGL) thickness, and Purkinje cell (PC) development.
Gene References Into Functions
Published Research Supporting FAIM2 Function:
  1. FAIM2 acts as an intrinsic neuroprotective factor activated by stress in photoreceptors, delaying Fas-mediated photoreceptor apoptosis. (PMID: 28708137)
  2. Faim2 deficiency leads to increased degeneration of dopaminergic neurons. (PMID: 27638043)
  3. In hyperglycemic conditions, miR-3202 promotes endothelial cell (EC) apoptosis, partially through targeting FAIM2. (PMID: 28228635)
  4. LFG (Lifeguard protein) protects T cells from apoptosis during antiviral immune responses. (PMID: 26565411)
  5. Faim2/LFG protects against FasL-induced apoptosis by downregulating calcium release from the endoplasmic reticulum in cortical neurons. (PMID: 26582200)
  6. Faim2-deficient mice exhibit increased hippocampal cell death during acute bacterial meningitis. (PMID: 24335530)
  7. Fas-receptor activation and subsequent ERK signaling trigger Faim2 expression. (PMID: 23029562)
  8. LFG inhibits the Fas pathway and provides neuroprotection in cerebellar granule neurons and Purkinje cells. (PMID: 21957071)
  9. Faim2 deficiency increases susceptibility to oxygen-glucose deprivation in neurons and worsens outcomes after cerebral ischemia. (PMID: 21209208)
  10. LFG, an endogenous inhibitor of FasL-mediated neuronal death, is found in lipid rafts and mediates FasL resistance in CNS neurons. (PMID: 17635665)
Database Links
Protein Families
BI1 family, LFG subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Membrane raft. Cell junction, synapse, postsynaptic cell membrane.
Tissue Specificity
Brain. Highly expressed in cerebellum, also found in cortex, olfactory bulb, and hippocampus.

Q&A

What is the molecular structure of Faim2 protein?

Faim2 is a 316 amino acid multipass membrane protein containing seven transmembrane domains. It structurally resembles Bax Inhibitor-1, another anti-apoptotic protein. The protein contains an N-terminal domain that can be targeted for antibody production (amino acids 1-72 in human FAIM2) . Faim2 belongs to a structurally defined family of proteins related to apoptosis named transmembrane BAX inhibitor motif-containing proteins (TMBIM) . This structural arrangement is critical for its function as it allows Faim2 to interact with membrane-bound death receptors, particularly the FAS receptor, to regulate apoptotic signaling pathways.

What are the primary functions of Faim2 in cells?

Faim2 functions primarily as an inhibitor of Fas-mediated apoptosis. It specifically protects cells from Fas-induced apoptosis by binding to the FAS receptor and reducing caspase activation . Overexpression of FAIM2 results in decreased caspase activation and reduced incidence of programmed cell death . Importantly, while Faim2 modulates Fas signal transduction, it does not protect cells from apoptosis mediated by TNF-α signaling, indicating its pathway specificity . In certain stress conditions, such as retinal detachment, FAIM2 acts as an intrinsic neuroprotective factor that delays FAS-mediated photoreceptor apoptosis . It also interacts with both p53 and HSP90 following activation of the FAS death pathway, with the FAIM2/HSP90 interaction depending on the phosphorylation status of FAIM2 .

What is the expression pattern of Faim2 in normal tissues?

While Faim2 is widely expressed throughout various tissues, its expression is particularly high in the central nervous system, especially in the hippocampus . It has been characterized as a neural membrane protein (also known as NMP35) that is highly expressed in the adult nervous system . Within neurons, Faim2 is localized at postsynaptic sites and in dendrites . This expression pattern suggests its importance in neuronal survival and function. The unique expression profile of Faim2 distinguishes it from other Fas inhibitory molecules (Faim1 and Faim3), which show different tissue distribution patterns .

How does Faim2 function in neurological disease models?

Studies using Faim2-deficient mouse models have revealed crucial insights into its role in neurological diseases. In models of transient cerebral ischemia, bacterial meningitis, and Parkinson's disease, Faim2-deficient mice exhibited increased neuronal cell death in the acute phase compared to wild-type controls . Interestingly, Faim2-deficient mice also showed signs of enhanced regeneration, suggesting Faim2 involvement in regenerative processes. The expression of Faim2 appears to be regulated in a disease stage-dependent manner, potentially enabling the switch between apoptotic and alternative Fas/CD95 signaling pathways . In experimental retinal detachment, photoreceptor apoptosis was accelerated in Faim2 knockout mice, with FAIM2 primarily involved in reducing stress-induced photoreceptor cell death, though this protective effect was transient .

What is the role of Faim2 in cancer progression and metastasis?

Faim2 has been identified as significantly involved in cancer biology, particularly in promoting cancer cell growth and metastasis. In non-small cell lung cancer (NSCLC), FAIM2 promotes cell growth and bone metastasis by regulating the epithelial-mesenchymal transition (EMT) process and the Wnt/β-catenin signaling pathway . Experimental studies demonstrated that FAIM2 expression levels correlate with metastatic potential, with higher expression in bone metastatic cell lines (HARA-B4) compared to parental cell lines (HARA) . Functionally, overexpression of FAIM2 in HARA cells increased cell viability, proliferation, migration, and invasion while reducing apoptosis. Conversely, knockdown of FAIM2 in HARA-B4 cells had the opposite effects . FAIM2 expression gradually decreased in both cell lines under anchorage-independent growth conditions, suggesting a relationship between FAIM2 and anchorage-dependent cell growth .

How can Faim2 serve as a biomarker in human cancers?

FAIM2 has been identified as a potential pan-cancer biomarker for prognosis and immune infiltration. Studies have analyzed the correlation between FAIM2 expression and various clinical parameters across multiple cancer types . In several tumor types including bladder cancer (BLCA), head and neck squamous cell carcinoma (HNSC), kidney renal papillary cell carcinoma (KIRP), liver hepatocellular carcinoma (LIHC), lung squamous cell carcinoma (LUSC), prostate adenocarcinoma (PRAD), skin cutaneous melanoma (SKCM), thyroid carcinoma (THCA), and uveal melanoma (UVM), FAIM2 expression positively correlates with ImmuneScore and StromalScore, suggesting its involvement in tumor immune microenvironment regulation . Additionally, FAIM2 expression has been found to positively correlate with CD8+ T cell infiltration in multiple tumor types based on various algorithms, particularly in basal breast cancer, KIRP, LUSC, pancreatic adenocarcinoma (PAAD), and SKCM .

What are the recommended methods for detecting Faim2 expression?

Several methods are commonly employed for detecting Faim2 expression in experimental settings:

  • Western Blotting: For protein-level detection, Western blotting using specific antibodies such as FAIM2 (H-7) can be applied. The recommended dilution range is 1:100-1:1000 for human, mouse, and rat FAIM2 .

  • Immunohistochemistry: For tissue-level visualization, researchers can follow this protocol:

    • Fix tissues in formalin and embed in paraffin

    • Cut into sections and deparaffinize/hydrate

    • Perform antigen retrieval using 10 mM sodium citrate (pH 6.0)

    • Incubate with 3% H2O2 for 10 minutes

    • Block with serum for 1 hour

    • Incubate with primary antibody (anti-FAIM2) at 4°C overnight

    • Incubate with secondary antibody at room temperature for 1 hour

    • Stain with DAB and counterstain with hematoxylin

    • Visualize using microscopy

  • PCR Analysis: For mRNA expression, quantitative reverse transcription PCR can be used to measure relative FAIM2 transcript levels compared to housekeeping genes .

What experimental models are suitable for studying Faim2 function?

Multiple experimental models have proven effective for studying Faim2 function:

  • Faim2 Knockout Mice: Generated by targeted deletion of the Faim2 gene, these mice exhibit increased susceptibility to neuronal cell death in various disease models, providing insights into Faim2's neuroprotective role .

  • Cell Culture Models:

    • NSCLC cell lines: HARA (parental) and HARA-B4 (bone metastatic) cell lines can be used to study FAIM2's role in cancer progression and metastasis .

    • Overexpression models: Transfection with pcD-FAIM2 to upregulate FAIM2 expression .

    • Knockdown models: Transfection with shFAIM2 to reduce FAIM2 expression. Multiple shRNAs can be tested to identify the most effective one for knockdown .

  • Retinal Detachment Models: Experimental retinal detachment in mice can be used to study FAIM2's role in photoreceptor protection and stress-induced apoptosis .

What functional assays are recommended for evaluating Faim2 activity?

Several functional assays have been validated for assessing Faim2 activity:

  • Cell Viability Assays:

    • CCK-8 assay can measure changes in cell viability following FAIM2 manipulation .

    • Flow cytometry for apoptosis detection using appropriate staining methods .

  • Proliferation Assays:

    • Colony formation assay to assess clonogenic potential .

    • EdU staining to quantify actively proliferating cells .

  • Migration and Invasion Assays:

    • Two-chamber Transwell assay for measuring cell migration and invasion capabilities .

    • Cell scratch assay (wound healing) to assess migratory potential over time .

  • Anoikis Resistance Assay:

    • Culture cells in low-adhesive dishes to measure survival under anchorage-independent conditions and quantify anoikis over time (e.g., Day 4 and Day 7) .

How does Faim2 modulate the Fas-mediated apoptotic pathway?

Faim2 modulates Fas-mediated apoptosis through several mechanisms. It specifically regulates apoptosis by binding directly to the FAS receptor, preventing the initiation of the death signaling cascade . Upon activation of the FAS death receptor via FAS-ligand, FAIM2 undergoes JNK-mediated phosphorylation, which decreases its proteasome-mediated degradation and increases its association with the FAS receptor . This phosphorylation-dependent regulation is crucial for FAIM2's protective function. Additionally, FAIM2 interacts with both p53 and HSP90 following FAS death pathway activation, with the FAIM2/HSP90 interaction being dependent on FAIM2 phosphorylation . The absence of FAIM2 leads to increased expression of pro-death genes such as Fas and Ripk1 in the retina under physiological conditions, indicating that FAIM2 also functions at the transcriptional level to control the expression of components in the death signaling pathway .

What signaling pathways interact with Faim2 in different cellular contexts?

Faim2 interacts with multiple signaling pathways in different cellular contexts:

  • FAS Death Receptor Pathway: The primary pathway modulated by Faim2, where it inhibits apoptotic signaling through direct interaction with the receptor .

  • JNK Signaling: JNK mediates the phosphorylation of FAIM2, which regulates its stability and association with the FAS receptor .

  • Wnt/β-catenin Pathway: In cancer cells, FAIM2 promotes growth and metastasis by modulating the Wnt/β-catenin signaling pathway .

  • Epithelial-Mesenchymal Transition (EMT): FAIM2 regulates the EMT process in cancer cells, contributing to increased invasiveness and metastatic potential .

  • Immune Cell Infiltration Pathways: FAIM2 expression correlates with immune cell infiltration, particularly CD8+ T cells, in various tumor types, suggesting interaction with immune regulatory pathways .

What are the transcriptional and post-translational regulations of Faim2?

Faim2 undergoes both transcriptional and post-translational regulation:

  • Transcriptional Regulation:

    • Expression levels of FAIM2 are regulated in a disease stage-dependent manner, suggesting dynamic transcriptional control during pathological processes .

    • In cancer cells, FAIM2 expression correlates with metastatic potential, indicating context-specific transcriptional regulation .

    • FAIM2 expression gradually decreases under anchorage-independent conditions, suggesting responsiveness to environmental cues .

  • Post-translational Regulation:

    • Phosphorylation: Following FAS receptor activation, FAIM2 undergoes JNK-mediated phosphorylation, which is critical for its function .

    • Proteasomal Degradation: FAIM2 is subject to proteasome-mediated degradation, which is reduced following its phosphorylation .

    • Protein Interactions: FAIM2 interactions with p53 and HSP90 are regulated by its phosphorylation status .

What are the current limitations in Faim2 research methodologies?

Current research on Faim2 faces several methodological challenges:

  • Specificity of Detection Tools: While antibodies for FAIM2 detection exist, their specificity across different experimental conditions and species may vary. Researchers should validate antibodies in their specific experimental systems .

  • Temporal Dynamics: FAIM2's protective effects appear to be transient in some contexts, such as photoreceptor protection following retinal detachment . Capturing these temporal dynamics requires careful experimental design with multiple time points.

  • Compensatory Mechanisms: In knockout models, compensatory upregulation of other anti-apoptotic proteins may confound interpretation of results. Complete pathway analysis is necessary to account for such effects.

  • Tissue-Specific Functions: Given FAIM2's differential expression across tissues, its function may vary significantly depending on the cellular context. Extrapolating findings from one tissue to another should be done cautiously.

  • Pathway Complexity: FAIM2 interacts with multiple signaling pathways and proteins, creating complex regulatory networks that are challenging to fully characterize with current methodologies.

How might targeting Faim2 contribute to therapeutic strategies?

Targeting Faim2 holds promise for several therapeutic applications:

  • Neuroprotection: Given FAIM2's role as an intrinsic neuroprotective factor, enhancing its expression or activity could be a potential therapeutic strategy for preventing neuronal death in conditions such as cerebral ischemia, bacterial meningitis, Parkinson's disease, and retinal detachment . Modulation of this pathway to increase FAIM2 expression may provide a therapeutic option to prevent photoreceptor death in retinal diseases .

  • Cancer Therapy: Conversely, in cancer contexts where FAIM2 promotes cell growth, survival, and metastasis, inhibiting FAIM2 could be beneficial. FAIM2 knockdown in cancer cells reduces proliferation, increases apoptosis, and decreases migration and invasion, suggesting potential anti-cancer effects . The correlation between FAIM2 expression and immune cell infiltration also suggests that FAIM2 modulation might influence immunotherapy responses .

  • Combination Therapies: Given FAIM2's interaction with multiple pathways, combining FAIM2-targeted approaches with other therapeutic strategies might enhance efficacy. For example, combining FAIM2 inhibition with Wnt/β-catenin pathway modulators might provide synergistic anti-cancer effects .

  • Biomarker-Guided Approaches: FAIM2's potential as a prognostic biomarker across multiple cancer types suggests its utility in guiding treatment decisions and monitoring therapeutic responses .

What novel experimental approaches could advance Faim2 research?

Several innovative approaches could accelerate progress in Faim2 research:

  • CRISPR-Cas9 Gene Editing: Precise genome editing could enable the creation of cell and animal models with specific FAIM2 mutations or domain deletions to dissect the functional importance of different protein regions.

  • Single-Cell Analysis: Applying single-cell transcriptomics and proteomics to study FAIM2 expression and function at the individual cell level could reveal heterogeneity in responses and identify cell-specific mechanisms.

  • Structural Biology Approaches: Determining the three-dimensional structure of FAIM2 and its interaction with binding partners could facilitate structure-based drug design targeting specific protein-protein interactions.

  • In Vivo Imaging: Developing methods for real-time visualization of FAIM2 activity in living organisms could provide insights into its dynamic regulation during disease progression and treatment.

  • Systems Biology Integration: Comprehensive integration of FAIM2-related data across multiple molecular levels (genomic, transcriptomic, proteomic, metabolomic) could reveal broader regulatory networks and unexpected connections to other cellular processes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.