Recombinant Mouse Protein lifeguard 3 (Tmbim1)

Shipped with Ice Packs
In Stock

Description

Apoptosis Regulation

Tmbim1 inhibits Fas receptor (CD95)-mediated extrinsic apoptosis by sequestering Fas in the Golgi, preventing its cell-surface translocation . Overexpression reduces caspase-8 activation, while knockdown increases susceptibility to apoptosis .

Calcium Homeostasis

Tmbim1 modulates endoplasmic reticulum (ER) calcium levels, influencing ER stress responses. It interacts with BAX to suppress pro-apoptotic signaling under stress conditions .

Mechanical Stress Adaptation

Originally identified as a shear-stress-responsive protein, Tmbim1 protects against cystic medial degeneration and aortic dilation in mice by mitigating mechanical stress-induced apoptosis .

Research Applications

  • Apoptosis Studies: Used to investigate Fas receptor trafficking and caspase-8 activation .

  • Calcium Signaling: Employed in ER calcium flux assays to study stress-response pathways .

  • Structural Biology: Serves as a template for analyzing transmembrane BAX inhibitor motifs (TMBIM) .

Comparative Analysis of Recombinant Variants

Product IDSpeciesTagExpression SystemLength (aa)
RFL7043MF MouseHisE. coli1–309
TMBIM1-3265H HumanGSTE. coli1–104
CSB-CF805910MO MouseNoneE. coliFull-length

Key Research Findings

  1. Developmental Essentiality:

    • Drosophila homologs (dTmbim5/6) are critical for survival, with knockdown causing ATP depletion and ER calcium dysregulation .

  2. Disease Models:

    • Tmbim1-deficient mice exhibit aortic pathologies, highlighting its role in vascular integrity .

  3. Mechanistic Insights:

    • Tmbim1’s N-terminal domain mediates Fas interaction, while its transmembrane regions regulate calcium flux .

Limitations and Considerations

  • Species Cross-Reactivity: Anti-Tmbim1 antibodies may show partial reactivity with rat/mouse homologs (~88% sequence homology) .

  • Endogenous Detection: Commercial antibodies (e.g., Rockland 200-401-A57) reliably detect overexpressed but not endogenous Tmbim1 in standard assays .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
All proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Tmbim1; Lfg3; Recs1; Protein lifeguard 3; Responsive to centrifugal force and shear stress gene 1 protein; Protein RECS1; Transmembrane BAX inhibitor motif-containing protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Tmbim1
Target Protein Sequence
MSNPSAPPPYEDHNPLYPGSPPPGGYGQPSVLPGGYPAYPAYPQPGYGHPAGYPQPVPPV HPMPMNYGHDYNEEERAGSDSFRPGEWDDRKVRHSFIQKVYCIISVQLLITVAIIAIFTF VEPVGKYVRNNVAVYYVSYAVFLVTYLTLACCQGPRRRFPWDIILLTIFTLALGFVTGTI SSMYENKAVIIAMIITAVVSISVTIFCFQTKVDFTSCTGLFCVLGIVLMVTGIVTSIVLI FKYIYWLHMVYAALGAICFTLFLAYDTQLVLGNRKHTISPEDYITGALQIYTDIVYIFTF VLQLVGSRD
Uniprot No.

Target Background

Function
TMBIM1 acts as a negative regulator of aortic matrix metalloproteinase-9 (MMP9) production. This protein may play a protective role in vascular remodeling.
Gene References Into Functions
  1. TMBIM1 effectively suppresses steatohepatitis and serves as a previously unidentified regulator of the multivesicular body (MVB)-lysosomal pathway. Hepatocyte Tmbim1 expression significantly inhibited high-fat diet-induced insulin resistance, hepatic steatosis, and inflammation in mice. Liver TMBIM1 overexpression effectively mitigated a severe form of NAFLD in mice. PMID: 28481357
  2. This endosomal/lysosomal membrane protein plays protective roles in vascular remodeling. PMID: 16607040
  3. RECS1 negatively regulates aortic MMP-9 production. The knockout of RECS1 induces susceptibility to aortic dilation and cystic medial degeneration in aged mice. PMID: 16636500
Database Links
Protein Families
BI1 family, LFG subfamily
Subcellular Location
Membrane; Multi-pass membrane protein. Lysosome membrane. Endosome membrane.
Tissue Specificity
Expressed in most tissues except spleen, thymus and testis.

Q&A

What is TMBIM1 and what are its alternative names in scientific literature?

TMBIM1 (Transmembrane BAX inhibitor motif-containing protein 1) is also known as Protein lifeguard 3 (LFG3) and Protein RECS1 homolog. Additional identifiers in databases include PP1201 and PSEC0158 . This protein belongs to the TMBIM family, characterized by the presence of transmembrane BAX inhibitor motifs that are involved in various cellular processes. The protein is evolutionarily conserved across species, with mouse and rat TMBIM1 sharing approximately 88% sequence homology with the human ortholog, particularly in the immunogenic regions used for antibody production .

What is the molecular structure and key domains of mouse TMBIM1?

Mouse TMBIM1 is a transmembrane protein with a molecular weight of approximately 35 kDa as detected by western blotting techniques . The protein contains multiple transmembrane domains characteristic of the TMBIM family, with the N-terminal region being particularly important for its functional activity. The full amino acid sequence includes distinctive regions that enable protein-protein interactions crucial for its biological functions. While the exact three-dimensional structure has not been fully elucidated in the provided search results, functional studies indicate that the protein's transmembrane domains are essential for its localization and subsequent activity in cellular compartments .

How is TMBIM1 expression regulated in normal tissues versus disease states?

TMBIM1 expression shows tissue-specific patterns, with notable overexpression documented in pathological conditions such as glioblastoma (GBM). Research indicates that TMBIM1 is significantly upregulated in GBM tissues compared to non-tumor tissues, and higher expression levels correlate with increased glioma malignancy . The regulatory mechanisms controlling TMBIM1 expression involve complex transcriptional and post-transcriptional processes that may be disrupted in disease states. In normal tissues, TMBIM1 appears to play roles in vascular homeostasis, as it negatively regulates aortic matrix metalloproteinase-9 (MMP9) production and may have a protective function in vascular remodeling . The contrast between normal physiological expression and pathological overexpression makes TMBIM1 an interesting target for differential expression studies in research contexts.

What are the optimal methods for detecting mouse TMBIM1 in experimental samples?

For detecting mouse TMBIM1 in experimental samples, several validated techniques can be employed depending on the research question. Western blotting represents a reliable approach using specific antibodies against TMBIM1, typically visualizing a band at approximately 35 kDa . When performing western blot analysis, optimal antibody dilutions range from 1:500 to 1:2000, though researchers should optimize conditions for their specific experimental setup .

For immunohistochemical (IHC) detection, polyclonal antibodies targeting the N-terminal region of TMBIM1 have shown efficacy . ELISA techniques can also be employed for quantitative analysis, with recommended antibody dilutions around 1:10000 . Importantly, current antibodies have demonstrated better detection of overexpressed TMBIM1 compared to endogenous levels, which should be considered when designing experiments . For all detection methods, appropriate positive and negative controls should be included to validate specificity, particularly when investigating mouse models where cross-reactivity with other TMBIM family members might occur.

How can researchers effectively use recombinant mouse TMBIM1 protein in functional assays?

Researchers can employ recombinant mouse TMBIM1 protein in multiple functional assays to investigate its biological activities. For proliferation studies, incorporating recombinant TMBIM1 into CCK-8 cell counting assays has proven effective for monitoring growth effects over 0-96 hour periods . When designing these experiments, it's critical to include appropriate controls and to test multiple concentrations of the recombinant protein to establish dose-response relationships.

For investigating TMBIM1's role in apoptosis, researchers can combine recombinant protein treatments with apoptotic stimuli (such as temozolomide for glioblastoma studies) to assess protective effects . Colony formation assays represent another valuable approach for evaluating TMBIM1's impact on cellular proliferation and survival, requiring approximately 500 cells per well and extended culture periods (approximately 2 weeks) to observe colony development . For all functional studies, researchers should consider the stability of recombinant TMBIM1 under experimental conditions, storing working aliquots at 4°C for up to one week and avoiding repeated freeze-thaw cycles that could compromise protein integrity .

What are the essential controls needed when conducting TMBIM1 knockdown or overexpression studies?

When conducting TMBIM1 knockdown or overexpression studies, multiple controls are essential to ensure experimental validity:

  • Vector controls: Empty vector transfections must be included alongside TMBIM1 overexpression constructs to account for vector-specific effects.

  • Scrambled/non-targeting controls: For knockdown experiments, scrambled or non-targeting siRNA/shRNA sequences are necessary to distinguish specific TMBIM1 suppression effects from general RNA interference responses .

  • Expression verification: Both protein and mRNA level verification of successful knockdown or overexpression using western blot and qRT-PCR, respectively.

  • Rescue experiments: To confirm phenotype specificity, researchers should conduct rescue experiments where TMBIM1 expression is restored in knockdown models.

  • Time-course evaluations: Examining effects at multiple time points can differentiate between primary and secondary consequences of TMBIM1 modulation.

Additionally, researchers should consider potential compensatory mechanisms by other TMBIM family members when interpreting results from long-term knockdown or overexpression studies. In vivo experiments with TMBIM1 knockdown have demonstrated significant effects on survival times in glioblastoma models, highlighting the importance of including appropriate controls when transitioning to animal studies .

How does TMBIM1 contribute to cancer progression, particularly in glioblastoma?

TMBIM1 contributes to cancer progression in glioblastoma through multiple mechanisms. Research has demonstrated that TMBIM1 is significantly overexpressed in GBM tissues, and high expression levels correlate with reduced patient survival times . At the cellular level, TMBIM1 promotes GBM cell proliferation and attenuates apoptosis, two hallmarks of aggressive cancer behavior. Knockdown of TMBIM1 in GBM cell lines (U87 and U251) induces cell cycle arrest and increases susceptibility to apoptosis both in vitro and in vivo .

Mechanistically, TMBIM1 interferes with the p38/MAPK pathway by inhibiting p38 phosphorylation, thereby promoting cell proliferation and attenuating apoptosis . Additionally, TMBIM1 plays a role in inducing Epithelial-Mesenchymal Transition (EMT), a process crucial for cancer cell invasion and metastasis, by stimulating autophagic degradation of E-cadherin via the AMPK/mTOR/ULK1 axis . The protein also reduces the sensitivity of GBM cells to temozolomide (TMZ), a standard chemotherapeutic agent for GBM treatment, suggesting its involvement in treatment resistance . In vivo experiments have confirmed the clinical relevance of these findings, as mice with TMBIM1 knockdown in GBM models showed significantly prolonged survival times .

What is the relationship between TMBIM1, autophagy, and Epithelial-Mesenchymal Transition?

The relationship between TMBIM1, autophagy, and Epithelial-Mesenchymal Transition (EMT) represents a complex interplay critical for understanding cancer progression. Research has demonstrated that TMBIM1 simultaneously induces both EMT and autophagy in glioblastoma models . Importantly, these processes are not merely parallel but interdependent, as experimental inhibition of autophagy effectively reverses TMBIM1-regulated EMT both in vitro and in vivo .

At the molecular level, TMBIM1 stimulates autophagic degradation of E-cadherin—a key epithelial marker whose loss is a defining feature of EMT—through activation of the AMPK/mTOR/ULK1 signaling axis . This mechanism provides a direct link between TMBIM1-induced autophagy and the acquisition of mesenchymal characteristics in cancer cells. The functional significance of this connection is evident in combined intervention studies where autophagy inhibitors (such as chloroquine/CQ) administered to TMBIM1 knockdown models resulted in significantly prolonged survival times in animal experiments . This suggests that therapeutic strategies targeting both TMBIM1 and autophagy pathways might provide synergistic benefits in treating cancers where EMT contributes to aggressive behavior and metastatic potential.

How does TMBIM1 influence apoptotic pathways in normal and pathological conditions?

TMBIM1 exerts significant influence over apoptotic pathways in both normal and pathological conditions. In glioblastoma models, TMBIM1 has been definitively shown to attenuate apoptosis, with knockdown of TMBIM1 inducing apoptotic cell death . This anti-apoptotic function appears to operate primarily through modulation of the p38/MAPK pathway, where TMBIM1 inhibits p38 phosphorylation, which normally promotes apoptosis when activated .

The protein's name itself—Transmembrane BAX inhibitor motif-containing protein 1—suggests evolutionary connections to apoptotic regulation, as BAX is a well-characterized pro-apoptotic protein. In pathological conditions like glioblastoma, TMBIM1's anti-apoptotic activity contributes directly to treatment resistance, as evidenced by reduced sensitivity to temozolomide (TMZ) in cells with high TMBIM1 expression . This chemoresistance mechanism represents a significant clinical challenge.

What are the key methodological challenges in studying mouse TMBIM1 interactions with other proteins?

Studying mouse TMBIM1 protein interactions presents several methodological challenges that researchers must address for reliable results. A primary difficulty is the limited ability of current antibodies to detect endogenous TMBIM1, with better recognition of overexpressed protein . This creates potential artifacts when studying physiological interactions versus those in overexpression systems. Additionally, TMBIM1's multiple transmembrane domains complicate traditional pull-down assays, requiring careful optimization of detergents to maintain protein structure while allowing solubilization.

Cross-reactivity concerns also arise when investigating TMBIM1-specific interactions, as the ~88% homology between mouse and human proteins, and potential similarities with other TMBIM family members, can lead to false positives . To overcome these challenges, researchers should employ multiple complementary approaches including:

  • Proximity ligation assays for in situ detection of protein interactions

  • CRISPR/Cas9 knock-in of epitope tags at endogenous loci to avoid overexpression artifacts

  • Reciprocal co-immunoprecipitation with controls for specificity validation

  • Mass spectrometry-based interactome analysis with stringent statistical thresholds

For signaling pathway studies, particularly those involving p38/MAPK or AMPK/mTOR/ULK1 axes where TMBIM1 has demonstrated involvement , time-course analyses are essential to distinguish direct from indirect interactions, as these pathways feature complex feedback and crosstalk mechanisms.

How can researchers differentiate between the functions of TMBIM1 and other TMBIM family members in experimental models?

Differentiating between functions of TMBIM1 and other TMBIM family members requires strategic experimental approaches to overcome their structural and functional similarities. Researchers should implement:

  • Specific genetic targeting: Using siRNA or CRISPR/Cas9 systems with validated specificity for TMBIM1 without affecting other family members. Following knockdown or knockout, qRT-PCR verification should confirm exclusive TMBIM1 targeting without compensatory changes in other TMBIM genes.

  • Domain swap experiments: Creating chimeric proteins where specific domains from TMBIM1 are exchanged with corresponding regions from other family members to identify unique functional domains.

  • Rescue experiments with specificity controls: When phenotypes are observed following TMBIM1 knockdown, rescue experiments should include not only wild-type TMBIM1 but also other family members to test for functional redundancy or uniqueness.

  • Comparative expression analysis: Comprehensive profiling of all TMBIM family members across experimental conditions using RNAseq or proteomics approaches to identify correlated or divergent expression patterns.

  • Subcellular localization studies: Detailed immunofluorescence or fractionation experiments to map the precise subcellular distribution of TMBIM1 versus other family members, as functional differences may relate to distinct localizations.

For specific processes like autophagic regulation or apoptosis inhibition where multiple TMBIM proteins may be involved, researchers should design pathway-specific experiments with selective inhibitors and activators to delineate the contribution of each family member. The collective implementation of these approaches will help distinguish unique TMBIM1 functions from shared family activities.

What are promising therapeutic approaches targeting TMBIM1 in cancer treatment, and what methodological considerations apply to preclinical studies?

Promising therapeutic approaches targeting TMBIM1 in cancer treatment include several strategic interventions supported by preclinical research:

  • RNA interference-based therapies: siRNA or shRNA targeting TMBIM1 has demonstrated efficacy in preclinical glioblastoma models, with TMBIM1 knockdown significantly prolonging survival times in animal studies . Methodological considerations include delivery optimization and off-target effect monitoring.

  • Combination therapies with autophagy inhibitors: Research has shown that autophagy inhibition (using chloroquine/CQ) synergistically enhances the anti-cancer effects of TMBIM1 knockdown, suggesting a promising combinatorial approach . Researchers must carefully calibrate dosing schedules and monitor potential systemic toxicities.

  • Small molecule inhibitors: Development of small molecules targeting TMBIM1 protein-protein interactions, particularly those involved in p38/MAPK pathway regulation . High-throughput screening methodologies followed by medicinal chemistry optimization represent key approaches.

  • Sensitization to standard therapies: TMBIM1 targeting could potentially reverse chemoresistance, as its high expression decreases sensitivity to temozolomide (TMZ) in glioblastoma . Studies should incorporate combination protocols with standard-of-care treatments.

For preclinical development, researchers should consider:

  • Establishing clear pharmacodynamic markers to confirm TMBIM1 pathway inhibition

  • Developing clinically relevant animal models that recapitulate human TMBIM1 expression patterns

  • Investigating potential compensatory mechanisms involving other TMBIM family members

  • Assessing long-term toxicity profiles, particularly given TMBIM1's normal physiological roles in vascular remodeling

  • Exploring biomarker strategies to identify patient populations most likely to benefit from TMBIM1-targeted interventions

The collective evidence indicates TMBIM1 represents a promising therapeutic target, particularly for aggressive cancers like glioblastoma where current treatment options remain limited.

What are the key knowledge gaps and future research priorities regarding TMBIM1 in developmental and disease contexts?

Despite significant progress in understanding TMBIM1 functions, several critical knowledge gaps remain that should guide future research priorities. First, the developmental roles of TMBIM1 are poorly characterized compared to its pathological functions in cancer. Research is needed to elucidate TMBIM1 expression patterns during embryonic and postnatal development, particularly in neural and vascular tissues where it appears to have significant functions . Transgenic mouse models with conditional TMBIM1 knockout would be valuable for investigating these developmental contexts.

Second, while TMBIM1's role in glioblastoma has been studied , its potential involvement in other cancer types remains largely unexplored. Comprehensive profiling across cancer types could identify additional therapeutic opportunities. Third, the molecular mechanisms connecting TMBIM1 to specific signaling pathways require further elucidation—particularly how it regulates p38 phosphorylation and connects to the AMPK/mTOR/ULK1 axis . Structural biology approaches, including cryo-EM studies of TMBIM1 in membrane environments, would provide valuable insights into its functional mechanisms.

Additionally, the relationship between TMBIM1 and other TMBIM family members warrants detailed investigation to understand potential redundancy or antagonism. Finally, translational research should focus on developing clinically viable TMBIM1-targeting strategies, including novel delivery methods for RNA therapeutics and small molecule inhibitor development, particularly for cancers demonstrating TMBIM1 overexpression and poor treatment response.

How can systems biology approaches advance our understanding of TMBIM1 in complex cellular networks?

Systems biology approaches offer powerful frameworks for unraveling TMBIM1's functions within complex cellular networks. Multi-omics integration—combining transcriptomics, proteomics, and metabolomics data from TMBIM1 manipulation experiments—can reveal emergent properties not apparent from single-method studies. This integration would be particularly valuable for understanding how TMBIM1 simultaneously affects multiple processes including autophagy, apoptosis, and EMT .

Network analysis algorithms applied to protein-protein interaction data can position TMBIM1 within larger signaling networks, identifying key nodes for intervention and potential compensatory mechanisms. Mathematical modeling of TMBIM1-influenced pathways, particularly the p38/MAPK and AMPK/mTOR/ULK1 axes, could predict system responses to perturbations and guide experimental design. Single-cell approaches are also crucial, as they can reveal heterogeneity in TMBIM1 expression and function across cell populations, which may be particularly relevant in tumor microenvironments.

Computational drug screening leveraging structural predictions of TMBIM1 could accelerate therapeutic development, while pathway flux analysis might explain how TMBIM1 regulates the balance between survival and death pathways in different cellular contexts. These systems approaches should be combined with targeted validation experiments to create an iterative research cycle that progressively refines our understanding of TMBIM1's complex roles in cellular homeostasis and disease pathogenesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.