Recombinant Mouse Protein Mpv17 (Mpv17)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipment of the format currently in stock. If you require a specific format, please specify this in your order notes.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping is available upon request with additional charges. Please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Mpv17; Protein Mpv17; Mpv-17
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-176
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Mpv17
Target Protein Sequence
MALWRAYQRALAAHPWKVQVLTAGSLMGVGDMISQQLVERRGLQQHQAGRTLTMVSLGCG FVGPVVGGWYKVLDHLIPGTTKVHALKKMLLDQGGFAPCFLGCFLPLVGILNGMSAQDNW AKLKRDYPDALITNYYLWPAVQLANFYLVPLHYRLAVVQCVAIVWNSYLSWKAHQF
Uniprot No.

Target Background

Function

Mpv17 is a non-selective ion channel that modulates membrane potential under both normal and oxidative stress conditions. It plays a crucial role in maintaining mitochondrial homeostasis, regulating the mitochondrial deoxynucleoside triphosphate (dNTP) pool, and preserving mitochondrial DNA (mtDNA). Mpv17 may also be involved in reactive oxygen species (ROS) metabolism and oxidative phosphorylation regulation.

Gene References Into Functions
  1. Elevated rGMP incorporation correlates with early-onset mtDNA depletion in the liver and late-onset multiple deletions in the brain of Mpv17-/- mice, suggesting that aberrant ribonucleotide incorporation is a primary cause of mtDNA abnormalities and subsequent pathology. PMID: 29106596
  2. Alterations in the expression of mitochondrial deoxynucleotide homeostasis factors indicate a remodeling of nucleotide metabolism in MPV17 disease models. PMID: 26760297
  3. The nuclear gene MPV17, mutations of which are associated with human hepatocerebral mitochondrial DNA depletion syndrome (MDDS), plays a currently undefined role in mtDNA maintenance. PMID: 25205723
  4. In podocytes, the inner mitochondrial membrane protein Mpv17 is essential for maintaining mitochondrial homeostasis and protecting against oxidative stress-induced injury both in vitro and in vivo. PMID: 24598802
  5. Loss of Mpv17 protein function in mitochondria appears to initiate tissue-specific cell death pathways, leading to the pathology observed during the degeneration process. PMID: 22322422
  6. Rhit acts as a repressor in the heat-induced and age-dependent transcriptional regulation of the (S) isoform of Mpv17-like protein. PMID: 20231359
  7. The functions of certain M-LP isoforms are tissue- and species-specific, suggesting that their involvement in ROS metabolism may be redundant or complemented by other Mpv17 family members. PMID: 19935920
  8. Studies demonstrate the existence of the human homolog of M-LP and its participation in ROS metabolism. PMID: 16631601
  9. Severe mtDNA depletion in the liver of Mpv17 knockout mice indicates that Mpv17 regulates mtDNA copy number via a highly tissue- and potentially cytotype-specific mechanism. PMID: 18818194
Database Links
Protein Families
Peroxisomal membrane protein PXMP2/4 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Tissue Specificity
High levels in heart, kidney, and brain, intermediate levels in testis, and low levels in liver and spleen.

Q&A

What is MPV17 and what is its cellular localization?

MPV17 is a mitochondrial inner membrane protein that plays critical roles in mitochondrial homeostasis. The protein is encoded by the Mpv17 gene, which was first identified through retroviral insertional mutagenesis in mice . Subcellular localization studies have consistently confirmed that MPV17 is specifically embedded in the inner mitochondrial membrane . This localization is crucial for its function in modulating membrane potential under both normal conditions and oxidative stress . The protein contains multiple transmembrane domains that anchor it to the mitochondrial inner membrane, positioning it to interact with other mitochondrial membrane proteins involved in various mitochondrial processes.

What are the primary experimental models used to study MPV17 function?

Several experimental models have been developed to study MPV17 function:

  • Global Mpv17 knockout mice: These were originally generated through recombinant retrovirus insertion to disrupt the Mpv17 gene . These mice, available from Jackson Laboratory (Stock No: 002208), serve as a valuable model for studying the systemic effects of MPV17 deficiency .

  • Cell culture models: Immortalized lung fibroblasts (LUSVX cells) and primary skin fibroblasts (SF4) derived from Mpv17-negative mice exhibit no Mpv17 mRNA expression but show high MMP-2 expression . These cellular models allow for transfection studies to examine the relationship between MPV17 and other cellular factors.

  • Transfection experiments: Researchers have utilized expression vectors like pBabePuroMpv17 containing the human MPV17 coding region to establish causal relationships between MPV17 expression and downstream effects .

  • Diabetic models: Streptozotocin (STZ) treatment of Mpv17-deficient mice has been used to study the role of MPV17 in diabetes progression .

What phenotypes are observed in Mpv17 knockout mice?

Mpv17 knockout mice display multiple tissue-specific phenotypes:

  • Renal manifestations: Early-onset glomerulosclerosis and proteinuria, although the severity appears to have diminished in later breeding generations, possibly due to changes in genetic background .

  • Inner ear abnormalities: Structural alterations similar to those seen in Alport syndrome .

  • Cardiovascular effects: Concomitant hypertension .

  • Liver abnormalities: Severe mitochondrial DNA depletion in the liver, mirroring human MPV17-related mitochondrial depletion syndrome .

  • Diabetes resistance: Surprisingly, Mpv17-deficient mice show resistance to diabetes induced by both streptozotocin treatment and insulin mutation (Ins2 Akita), with significantly less severe β-cell loss and apoptosis compared to wild-type mice .

How does MPV17 regulate mitochondrial DNA maintenance?

MPV17 plays a crucial role in mitochondrial DNA (mtDNA) maintenance through multiple mechanisms:

  • Regulation of dNTP pools: MPV17 is involved in mitochondrial deoxynucleoside triphosphates (dNTP) pool homeostasis, which is essential for proper mtDNA replication . Disruption of this function leads to mtDNA depletion in specific tissues.

  • Tissue-specific effects: The impact of MPV17 deficiency on mtDNA levels varies dramatically across tissues. In Mpv17 knockout mice, severe mtDNA depletion occurs in the liver and to a lesser extent in skeletal muscle, while brain and kidney tissues show minimal depletion even up to one year after birth .

  • Connection to human disease: Mutations in human MPV17 cause hepatocerebral mitochondrial DNA depletion syndrome (MDDS), indicating conservation of this critical function across species .

What is the paradoxical role of MPV17 in β-cell apoptosis and diabetes?

MPV17 exhibits a striking paradoxical role in β-cell apoptosis compared to its function in other cell types:

  • Pro-apoptotic in β-cells: In pancreatic β-cells, MPV17 promotes apoptosis, as evidenced by the resistance of Mpv17-deficient mice to diabetes in both streptozotocin (STZ) and Ins2 Akita models . When treated with STZ, Mpv17 knockout mice showed:

    • Significantly lower blood glucose levels than wild-type and heterozygous mice

    • Attenuated reduction in the percentage of β-cells in islets

    • Reduced β-cell apoptosis

  • Anti-apoptotic in other cells: Conversely, in many other cell types, MPV17 deficiency causes increased reactive oxygen species (ROS) and promotes apoptosis, suggesting MPV17 normally plays a protective role .

  • Cell-autonomous effects: The expression of MPV17 in β-cells of normal mice suggests that its pro-apoptotic effect in diabetes is β-cell autonomous .

This tissue-specific dichotomy in MPV17 function represents a fascinating area for further investigation, particularly regarding the molecular switches that determine whether MPV17 promotes or prevents apoptosis in different cellular contexts.

How does MPV17 interact with matrix metalloproteinases and affect basement membrane integrity?

Research has established an inverse causal relationship between MPV17 expression and matrix metalloproteinase-2 (MMP-2) regulation:

  • Increased MMP-2 in MPV17 deficiency: The absence of the Mpv17 gene product causes a strong increase in MMP-2 expression in kidney, cochlea, and tissue culture cells derived from Mpv17-negative mice .

  • Repression mechanism: When Mpv17-negative cells are transfected with the human MPV17 homolog, MMP-2 expression is repressed at both the mRNA level and enzymatic activity level, establishing a clear inverse relationship .

  • Link to phenotypes: This MMP-2 dysregulation may mediate the mechanisms leading to glomerulosclerosis, inner ear disease, and hypertension in the Mpv17 mouse model .

  • Basement membrane connection: Since MMP-2 is involved in basement membrane metabolism, particularly affecting components like type IV collagen that are major constituents of glomerular and cochlear basement membranes, the MPV17-MMP-2 relationship provides a mechanistic explanation for the observed phenotypes .

The regulatory pathway connecting MPV17 (a peroxisomal/mitochondrial protein involved in reactive oxygen metabolism) to MMP-2 expression likely involves signaling intermediates that remain to be fully characterized.

What methods are most effective for assessing MPV17 function in different experimental systems?

Researchers investigating MPV17 function should consider multiple methodological approaches:

  • Mitochondrial DNA quantification:

    • qPCR analysis to measure mtDNA copy number in different tissues of Mpv17 knockout versus wild-type mice

    • Assessment of mtDNA depletion as a function of age in different tissues

  • Cell viability and apoptosis assays:

    • TUNEL assay for detecting apoptotic β-cells in pancreatic sections

    • Caspase 3 activation monitoring in cultured cells with modified MPV17 expression

    • Cell viability assays in response to stressors like streptozotocin or palmitic acid

  • Protein interaction studies:

    • Immunoprecipitation coupled with mass spectrometry to identify MPV17-interacting proteins

    • Analysis of interactions with critical components like ATP synthase, Cyclophilin D, MIC60, and GRP75

  • Mitochondrial function assessment:

    • ROS measurement in MPV17-deficient versus wild-type tissues or cells

    • Mitochondrial calcium retention capacity testing

    • Evaluation of mitochondrial membrane potential

  • MMP-2 activity measurement:

    • In-gel gelatinase assays to monitor MMP-2 enzymatic activity in cell culture supernatants

    • Northern blot analysis to assess MMP-2 mRNA levels in relation to MPV17 expression

How should researchers approach tissue-specific analysis of MPV17 function?

Given the distinct tissue-specific effects of MPV17 deficiency, researchers should adopt tailored approaches:

  • Liver studies: Focus on severe mtDNA depletion, which mirrors human MPV17-related diseases. Monitor mtDNA levels at different developmental stages using quantitative PCR techniques .

  • Pancreatic β-cell analysis:

    • Insulin staining of pancreatic islets to quantify β-cell percentage

    • Assessment of islet size

    • TUNEL assay for apoptosis detection

    • Analysis of blood glucose levels in response to diabetogenic stimuli

  • Cardiac tissue evaluation:

    • Functional recovery assessment following ischemia/reperfusion

    • Mitochondrial structural damage analysis using electron microscopy

    • Calcium retention capacity measurement in isolated mitochondria

    • Investigation of MPV17 interactions with proteins involved in mitochondrial cristae organization

  • Renal studies:

    • Analysis of glomerulosclerosis progression

    • MMP-2 expression monitoring

    • Basement membrane integrity assessment

When comparing data across tissues, researchers should consider that MPV17 performs different functions in different cellular contexts, necessitating careful interpretation of apparently contradictory results.

How do mouse models of MPV17 deficiency compare to human MPV17-related disorders?

Comparison between mouse models and human MPV17-related disorders reveals important similarities and differences:

What are the implications of MPV17's role in diabetes resistance for therapeutic development?

The unexpected finding that MPV17 deficiency confers resistance to diabetes opens several therapeutic avenues:

  • Potential therapeutic targets:

    • MPV17 inhibition specifically in β-cells might protect against diabetes-related β-cell death

    • Downstream effectors in the MPV17 pathway in β-cells could represent novel targets for anti-diabetic drug development

  • Considerations for research:

    • The pro-apoptotic effect of MPV17 in β-cells contrasts with its anti-apoptotic role in other tissues, requiring careful tissue-targeted approach to any therapeutic intervention

    • Understanding the molecular mechanism of this tissue-specific dichotomy could reveal fundamental insights into β-cell biology and survival

  • Experimental approaches:

    • Development of β-cell-specific MPV17 knockdown models

    • High-throughput screening for compounds that modulate MPV17 activity or expression in β-cells

    • Investigation of MPV17 expression in diabetic human samples to validate relevance to human disease

The paradoxical tissue-specific effects of MPV17 highlight the importance of targeted approaches in developing potential therapeutics based on MPV17 biology.

What are the major unresolved questions in MPV17 research?

Several critical questions remain unanswered in the field of MPV17 research:

  • Molecular function: Despite identification of MPV17 as a non-selective channel in the mitochondrial inner membrane , the precise molecular mechanisms through which it influences mtDNA maintenance, ROS metabolism, and tissue-specific effects remain unclear.

  • Regulatory pathways: The signaling pathways connecting MPV17 to MMP-2 expression and other downstream effects need further elucidation .

  • Tissue specificity: The basis for the dramatic tissue-specific effects of MPV17 deficiency, particularly the contrasting roles in β-cell apoptosis versus other cell types, remains a major question .

  • Developmental aspects: The temporal dynamics of MPV17 function during development and aging require further investigation.

  • Human relevance: The full spectrum of human diseases potentially influenced by MPV17 dysfunction beyond classical mitochondrial DNA depletion syndrome remains to be defined.

What new technologies and approaches might advance MPV17 research?

Future MPV17 research would benefit from several emerging technologies and approaches:

  • CRISPR-Cas9 gene editing: Creation of tissue-specific and inducible MPV17 knockout models to better understand context-dependent functions.

  • Single-cell omics: Application of single-cell transcriptomics and proteomics to identify cell-specific effects of MPV17 deficiency.

  • Advanced mitochondrial imaging: Super-resolution microscopy and live-cell imaging to visualize MPV17 dynamics within the mitochondrial inner membrane.

  • Metabolomics: Comprehensive metabolic profiling to identify alterations in metabolic pathways associated with MPV17 dysfunction.

  • Structural biology: Determination of MPV17 protein structure to understand its channel properties and interactions with partner proteins.

  • Human iPSC models: Development of patient-derived induced pluripotent stem cells to model human MPV17-related disorders and test potential therapeutics.

  • Systems biology approaches: Integration of multiple data types to model the complex networks influenced by MPV17 function in different cellular contexts.

These advances would help resolve current controversies and potentially lead to novel therapeutic strategies for MPV17-related disorders and possibly for conditions like diabetes where MPV17 modulation might provide unexpected benefits.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.