Recombinant Mouse Protein NKG7 (Nkg7)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

NKG7 is encoded by the Nkg7 gene and localizes to lysosomes and late endosomes. Structural studies reveal it interacts with vacuolar ATPase (v-ATPase) subunits (ATP6V0d1 and ATP6AP2) to modulate lysosomal proton pump activity . Key features include:

  • Domains: Four transmembrane helices with cytoplasmic N- and C-termini .

  • Expression: Restricted to cytotoxic lymphocytes (CD8+ T cells, NK cells) .

Lysosomal Dynamics and mTORC1 Regulation

NKG7 inhibits v-ATPase assembly, reducing lysosomal acidity and mTORC1 recruitment . Consequences include:

  • Lysosome Morphology:

    ConditionLysosome PhenotypemTORC1 Activity
    NKG7 Knockout (KO)Enlarged, aggregated lysosomesIncreased
    NKG7 OverexpressionSmaller, dispersed lysosomesDecreased
  • Metabolic Impact: NKG7-deficient CD8+ T cells exhibit hyperactive glycolysis and oxidative phosphorylation due to unchecked mTORC1 signaling .

Immune Synapse Efficiency

NKG7 enhances cytotoxic granule release and shortens immune synapse duration:

  • Synapse Duration:

    • Wild-type CD8+ T cells: 15–30 minutes .

    • Nkg7<sup>-/-</sup> CD8+ T cells: Prolonged (>45 minutes), leading to cytokine hypersecretion (e.g., TNF) .

  • Tumor Killing: NKG7 overexpression in CD8+ T cells increases IFN-γ<sup>+</sup> and CD107a<sup>+</sup> cells in tumors, improving anti-tumor control .

Anti-Tumor Activity

  • NKG7 Transgenic (Tg) Mice:

    • Delayed MC38 tumor growth (50% reduction vs. controls at day 17) .

    • Increased tumor-infiltrating CD8+ T cells (2.5-fold higher) .

Infection Models

  • Visceral Leishmaniasis:

    • Nkg7<sup>-/-</sup> mice showed 3-fold higher liver parasite burden and reduced IFN-γ/TNF levels .

  • Chronic Viral Infection:

    • NKG7 KO mice exhibited impaired memory CD8+ T cell formation .

Prognostic Value in Cancer

  • Bladder Cancer (TCGA Data):

    NKG7 ExpressionMedian Survival (Years)Hazard Ratio (95% CI)
    High18.90.49 (0.34–0.73)
    Low2.65Reference
  • Mechanism: High NKG7 correlates with enhanced CD8+ T cell infiltration and cytokine production .

Therapeutic Implications

NKG7’s dual role in cytotoxicity and inflammation modulation positions it as a therapeutic target:

  • Overexpression Strategies: Augmenting NKG7 in CD8+ T cells improves tumor control without altering granzyme/perforin levels .

  • Inhibition Risks: NKG7 deficiency compensates via TNF-driven tumor death but exacerbates chronic inflammation .

Research Gaps and Future Directions

  • Molecular Mechanisms: How NKG7 regulates lysosomal trafficking remains unclear .

  • Clinical Translation: Recombinant NKG7 protein’s efficacy in adoptive cell therapy warrants exploration.

Product Specs

Buffer
The storage buffer depends on the delivery form. For liquid preparations, a Tris/PBS-based buffer containing 5-50% glycerol is used. Lyophilized powder is prepared using a Tris/PBS-based buffer with 6% Trehalose before lyophilization.
Form
Liquid or Lyophilized Powder
Note: While we prioritize shipping the available format, specific requests can be accommodated. Please indicate your preferred format in order notes.
Lead Time
Delivery times vary based on purchase method and location. Please consult your local distributor for precise delivery estimates.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard protocol uses 50% glycerol.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
N-terminal 10xHis-tag
Datasheet & Coa
Please contact us to get it.
Expression Region
1-165aa
Mol. Weight
19.5 kDa
Protein Length
Full Length
Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Others
Source
in vitro E.coli expression system
Species
Mus musculus (Mouse)
Target Names
Nkg7
Target Protein Sequence
MEPCRSLALFAGSLGLTSSLIALTTDFWIVATGPHFSAHSGLWPTSQETQVAGYIHVTQSFCILAVLWGLVSVSFLILSCIPALSAPGRGPLVSTVMAFSAALSILVAMAVYTSMRWSQTPFSQVQTFFSWSFYLGWVSFILFLFAGCLSLGAHCRTRRAEYETL
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Database Links
Protein Families
PMP-22/EMP/MP20 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cytolytic granule membrane; Multi-pass membrane protein.

Q&A

What is NKG7 and where is it primarily expressed?

NKG7 (Natural Killer Group 7), also known as granule membrane protein-17 (GMP-17), is a 4-transmembrane spanning protein discovered approximately 30 years ago that localizes to the lysosome. NKG7 expression is largely restricted to cytotoxic immune cells, with highest expression observed in CD8+ T cells and natural killer (NK) cells . The protein was initially identified in cytotoxic granules but has subsequently been recognized to have broader functions in lysosomal biology. The gene encoding NKG7 is conserved across mammalian species, suggesting evolutionary importance in immune function. Studies have employed various techniques to characterize NKG7 expression, including flow cytometry, immunofluorescence microscopy, and transcriptomic approaches.

For researchers studying NKG7 expression patterns, multiparameter flow cytometry provides the most quantitative approach, allowing simultaneous assessment of NKG7 levels alongside markers of T cell activation, differentiation, and functional status. Single-cell RNA sequencing has further revealed heterogeneity in NKG7 expression within cytotoxic lymphocyte populations, suggesting potential functional specialization among NKG7-expressing cells. When performing immunofluorescence studies, appropriate permeabilization techniques are essential for accessing the intracellular, lysosome-localized NKG7 protein.

What are the primary biological functions of NKG7 in immune cells?

NKG7 demonstrates multiple distinct biological functions in cytotoxic immune cells that collectively influence both immediate effector functions and long-term immune responses. First, NKG7 regulates lytic granule secretion, which is essential for the killing function of CD8+ T cells and NK cells . This process involves the controlled release of perforin and granzymes to eliminate target cells. Additionally, NKG7 serves as a negative regulator of mTORC1 recruitment and activation, thereby modulating metabolic processes in CD8+ T cells . This metabolic regulation significantly impacts T cell differentiation and longevity.

Beyond these primary functions, NKG7 promotes CD8+ T cell durability and memory generation, which is particularly important for establishing long-lived immune responses to both acute and chronic viral infections . The protein also enhances anti-tumor immunity by facilitating increased tumor infiltration by CD8+ T cells, correlating with improved survival outcomes in cancer patients . These diverse functions highlight NKG7's role as a multifunctional regulator of cytotoxic lymphocyte biology rather than simply a structural component of cytotoxic granules as initially thought.

Methodologically, researchers can assess these functions through cytotoxicity assays (e.g., chromium release or real-time cell analysis systems), phospho-flow cytometry to measure mTORC1 signaling, and adoptive transfer experiments to track memory formation in vivo. Each experimental approach should include appropriate positive and negative controls to account for the multifaceted nature of NKG7's biological activities.

How does NKG7 regulate lysosomal structure and function?

NKG7 exerts significant effects on lysosomal architecture and activity through multiple mechanisms affecting organelle morphology, acidity, and protein interactions. Loss of NKG7 in CD8+ T cells results in larger but fewer Lamp1+ lysosomes, likely due to aberrant late endosome/lysosome fusion events. Conversely, experimental overexpression of NKG7 in cells that do not normally express this protein leads to more numerous but smaller lysosomes . These morphological changes suggest that NKG7 plays a role in regulating lysosomal biogenesis and fusion events.

At the molecular level, NKG7 inhibits v-ATPase proton pump activity, thereby modulating lysosomal pH. The vacuolar ATPase (v-ATPase) is a multi-subunit complex responsible for acidifying lysosomes through ATP-dependent proton transport. In the absence of NKG7, v-ATPase activity becomes dysregulated, resulting in increased lysosomal acidity . Mechanistically, NKG7 interacts with components of the v-ATPase complex, specifically with the membrane-integrated V0 domain component ATP6V0d1 and the V0 domain-associated accessory subunit ATP6AP2 . These interactions appear to prevent the proper assembly of the V1 and V0 domains of the v-ATPase, which is required for its functional activity.

Researchers investigating these effects should employ complementary approaches including LysoTracker staining to assess lysosomal acidity, co-immunoprecipitation to detect protein-protein interactions, and proximity ligation assays to visualize complex formation in situ. Subcellular fractionation techniques can further distinguish between membrane-bound and cytosolic v-ATPase components to assess NKG7's impact on proper complex assembly.

What is the relationship between NKG7 and mTORC1 signaling?

NKG7 functions as a negative regulator of mTORC1 (mechanistic target of rapamycin complex 1) signaling through a sophisticated mechanism involving lysosomal protein complexes. The research demonstrates that NKG7 impairs the assembly of V1 and V0 v-ATPase domains on the lysosomal membrane, which is a prerequisite step for mTORC1 activation . This inhibition disrupts the typical amino acid sensing mechanism required for mTORC1 activity. v-ATPase activity is critical for this process, as treatment with inhibitors like BafA1 or concanamycin A impairs mTORC1 activation regardless of NKG7 status .

Beyond directly affecting v-ATPase assembly, NKG7 disrupts the recruitment of the Ragulator complex to lysosomes. The Ragulator complex serves as an anchor for Rag GTPases, which in turn recruit mTORC1 to the lysosomal surface where it can be activated. Proteomic analyses identified potential interactions between NKG7 and components of this regulatory machinery, including RagC (a Rag GTPase subunit) and LAMTOR1 (a Ragulator complex subunit) . By interfering with the interaction between v-ATPase and the Ragulator complex, NKG7 impairs lysosomal mTORC1 activation and subsequent metabolic signaling.

Experimental approaches to study this relationship include western blotting to detect phosphorylation of mTORC1 targets (S6K, 4E-BP1), immunofluorescence to visualize mTORC1 localization, and pharmacological manipulations using v-ATPase or mTOR inhibitors. For thorough understanding, researchers should examine these pathways under various conditions including nutrient sufficiency and starvation to capture the dynamic nature of mTORC1 regulation.

How does NKG7 influence CD8+ T cell responses to infection and cancer?

NKG7 profoundly shapes CD8+ T cell responses through several mechanisms that affect both immediate effector functions and long-term memory formation. During the effector phase, NKG7 regulates lytic granule release, directly impacting the cytotoxic capacity of CD8+ T cells against virally infected or malignant cells . This cytotoxic function represents the primary mechanism through which CD8+ T cells eliminate targets, making NKG7's role in this process highly significant for protective immunity.

By inhibiting mTORC1 activity, NKG7 also modulates cellular metabolism, which profoundly influences T cell fate decisions. This metabolic regulation is particularly crucial for memory formation, as excessive mTORC1 activity can drive terminal differentiation at the expense of memory precursor development. Indeed, research demonstrates that NKG7-mediated negative regulation of mTORC1 is required for the generation of long-lived CD8+ T cell responses to both acute and chronic viral infections . In the context of tumor immunity, CD8+ T cell-specific overexpression of NKG7 promotes greater accumulation of T cells within tumors and enhances functionally active (IFN-γ+ and CD107a+) CD8+ T cell populations .

Clinical relevance of these findings is supported by patient data showing that high NKG7 expression in tumor-infiltrating lymphocytes correlates with improved survival across multiple cancer types. In bladder cancer specifically, patients with high NKG7 expression demonstrated a median survival time of 18.9 years compared to just 2.65 years for those with low NKG7 expression (p < 0.0001) . These findings establish NKG7 as both a mechanistic regulator of T cell function and a potential prognostic biomarker.

What are the molecular mechanisms by which NKG7 inhibits v-ATPase assembly?

The molecular basis of NKG7-mediated inhibition of v-ATPase assembly involves specific protein interactions that prevent proper complex formation and function. Proteomic analyses, including NKG7-immunoprecipitation followed by mass spectrometry and NKG7-proximity labeling via TurboID, have identified direct interactions between NKG7 and critical v-ATPase components, specifically ATP6V0d1 (a V0 domain component) and ATP6AP2 (a V0 domain-associated accessory subunit) . These interactions appear to primarily occur with the membrane-embedded V0 domain rather than the cytosolic V1 domain of the v-ATPase complex.

Functionally, NKG7 prevents the association of the membrane-bound V0 domain with the cytosolic V1 domain, which is required for complete v-ATPase assembly and activity. This inhibitory effect has been demonstrated through proximity ligation assays (PLA) between V0 subunit (ATP6V0a4) and V1 subunit (ATP6V1B1), where NKG7 expression reduced the number of PLA puncta within cells, indicating fewer instances of V0-V1 association . Additional membrane fractionation studies showed that NKG7 expression reduced the presence of V1 domain subunits in membrane fractions, further supporting the model that NKG7 impairs recruitment of the cytosolic V1 complex to the membrane-bound V0 domain .

For researchers investigating these mechanisms, optimal approaches include proximity-based techniques like BioID or APEX2 labeling to identify the interaction network surrounding NKG7, structural studies to characterize binding interfaces, and mutagenesis approaches to identify critical residues mediating these interactions. Combined with functional readouts of v-ATPase activity, these techniques can provide comprehensive understanding of how NKG7 regulates this essential cellular machinery.

How can researchers effectively generate and validate NKG7 knockout or transgenic mouse models?

Creating reliable genetic models to study NKG7 function requires careful design and comprehensive validation strategies. Based on published approaches , researchers have successfully generated several NKG7 genetic models with specific considerations for targeting strategy and validation methodology. For NKG7-floxed mice, targeting vectors typically include LoxP sites flanking the genomic region spanning exons 1-4, with the distal LoxP positioned upstream of exon 1 and a LoxP-FRT flanked Neo cassette inserted downstream of exon 4 . This design allows for conditional deletion in specific cell types when crossed with appropriate Cre-expressing lines.

For overexpression models, researchers have generated CD8+ T cell-specific NKG7 transgenic mice by crossing E8I CD8-Cre mice with CAG2-NKG7-Rosa26-IRES-tdTomato mice . The construct design includes a LoxP-flanked Neo stop selection marker downstream of the pCAG promoter followed by an NKG7-IRES-tdTomato-WPRE-BGHpA cassette. This approach enables cell type-specific NKG7 overexpression alongside a fluorescent reporter (tdTomato) for easy identification of transgene-expressing cells.

Validation of these models should follow a multi-tiered approach including: (1) Genotyping PCR to confirm genetic modifications using specific primers that span the targeted region; (2) Expression analysis via western blotting, flow cytometry, and qPCR to verify altered NKG7 levels; (3) Functional testing to assess phenotypic changes in pathways known to be regulated by NKG7, particularly v-ATPase activity and mTORC1 signaling; and (4) Rescue experiments by reintroducing NKG7 in knockout models to confirm specificity of observed phenotypes. The inclusion of appropriate reporter genes (such as tdTomato) facilitates tracking of cells with altered NKG7 expression, particularly valuable for adoptive transfer and lineage tracing experiments.

What techniques are most effective for studying NKG7-mediated regulation of mTORC1 activity?

Investigating NKG7's role in mTORC1 regulation requires an integrated experimental approach combining biochemical, microscopy-based, and functional methodologies. Western blotting remains the gold standard for quantifying mTORC1 pathway activation by measuring phosphorylation of downstream targets including p70 S6 kinase (S6K), ribosomal protein S6, and the eukaryotic translation initiation factor 4E-binding protein 1 (4E-BP1) . When performing these assays, researchers should include conditions that dynamically regulate mTORC1 (such as amino acid starvation and refeeding) to capture the regulatory role of NKG7.

Microscopy techniques provide crucial spatial information about mTORC1 localization. Immunofluorescence microscopy can visualize co-localization of mTORC1 components (particularly mTOR and Raptor) with lysosomal markers (LAMP1, LAMP2) to assess recruitment to the lysosomal surface. Proximity ligation assays (PLA) offer higher sensitivity for detecting protein-protein interactions between NKG7, v-ATPase subunits, and Ragulator components within a 40 nm radius . This technique has successfully demonstrated that NKG7 expression affects the assembly of v-ATPase domains and their interaction with the Ragulator complex.

Functional assessment of mTORC1 activity downstream of NKG7 should include metabolic analyses, as mTORC1 is a master regulator of cellular metabolism. Seahorse extracellular flux analysis can measure glycolysis and oxidative phosphorylation rates in cells with altered NKG7 expression. Additionally, pharmacological approaches using v-ATPase inhibitors (BafA1, concanamycin A, salicylihalamide A) have proven valuable for validating the mechanistic connection between v-ATPase activity and mTORC1 regulation in the context of NKG7 manipulation . Genetic approaches, such as CRISPR-mediated deletion of ATP6AP2 (a v-ATPase accessory subunit that interacts with NKG7), have successfully demonstrated the requirement for v-ATPase in NKG7-mediated mTORC1 regulation .

How does NKG7 expression correlate with clinical outcomes in different cancer types?

These findings suggest that NKG7 expression could serve as a valuable prognostic biomarker across multiple cancer types. The strong and consistent association with favorable outcomes implies that NKG7-expressing cytotoxic lymphocytes may possess enhanced anti-tumor functionality, consistent with the experimental findings regarding NKG7's role in CD8+ T cell function and tumor infiltration.

What methods should be used for investigating NKG7-protein interactions in primary T cells?

Traditional co-immunoprecipitation remains valuable when sufficient cell numbers can be obtained. Researchers have successfully performed co-IP of endogenously expressed proteins in expanded CD8+ T cells to validate interactions between NKG7 and v-ATPase components like ATP6V0d1 . Chemical crosslinking prior to immunoprecipitation can help stabilize transient interactions that might otherwise be lost during cell lysis and washing steps. For structural analysis, cryo-electron microscopy of isolated protein complexes can provide detailed insights into the molecular basis of NKG7's interactions with v-ATPase components.

Methodological considerations when studying NKG7 interactions include careful selection of detergents for cell lysis (to preserve membrane protein interactions), appropriate controls (isotype antibodies, NKG7-deficient cells), and validation through multiple complementary techniques. Researchers may also consider using cell lines transfected with tagged versions of NKG7 for initial screening before validation in primary cells. Domain mapping through truncation or site-directed mutagenesis can further identify specific regions of NKG7 responsible for particular protein interactions.

How can researchers distinguish between NKG7's effects on cytotoxicity versus its effects on mTORC1 signaling?

Disentangling NKG7's dual functions in regulating cytotoxicity and mTORC1 signaling requires experimental strategies that can selectively assess each pathway. Structure-function approaches represent a powerful method, where researchers can generate domain-specific mutants of NKG7 that selectively affect either cytotoxicity or mTORC1 interaction. These mutants can then be expressed in NKG7-deficient cells to determine which domains are required for each function. While the exact domains mediating these functions haven't been fully mapped, the research suggests that NKG7's interaction with v-ATPase components (particularly ATP6V0d1 and ATP6AP2) is critical for its effects on mTORC1 signaling .

Pharmacological interventions offer another approach to dissect these pathways. Treatment with v-ATPase inhibitors like Bafilomycin A1 (BafA1) can reverse mTORC1 hyperactivation in NKG7-knockout CD8+ T cells without necessarily affecting all aspects of cytotoxic function . Similarly, rapamycin can inhibit mTORC1 signaling downstream of NKG7, allowing researchers to determine which phenotypes are mTORC1-dependent versus those that rely on other NKG7 functions. Temporal analysis can further separate immediate effects (likely cytotoxicity-related) from delayed responses (typically mTORC1-related).

Experimental readouts should be carefully selected to distinguish between these functions. For cytotoxicity assessment, researchers can measure degranulation (CD107a surface expression), target cell killing in vitro, and perforin/granzyme release. Research has shown that NKG7 transgenic mice display enhanced delivery or trafficking of lytic granules but unaltered content of perforin and granzyme B, suggesting specific effects on granule mobilization . For mTORC1 signaling, phosphorylation of S6K/S6/4E-BP1, metabolic profiling (glycolysis, oxidative phosphorylation), and gene expression analysis of mTORC1-regulated genes provide reliable readouts. By systematically analyzing these different parameters, researchers can effectively distinguish between NKG7's various functions.

What are the optimal techniques for evaluating NKG7-mediated effects on lysosomal acidity and v-ATPase activity?

Accurate assessment of lysosomal acidity and v-ATPase function requires specialized techniques that have been successfully employed in NKG7 research. For measuring lysosomal acidity, LysoTracker dyes represent the most accessible approach, as these acidotropic probes accumulate in acidic organelles and can be quantified by flow cytometry or microscopy. More sophisticated approaches include the use of pH-sensitive fluorescent proteins targeted to lysosomes or ratiometric pH indicators that provide quantitative pH measurements across a range of values. These techniques have demonstrated that NKG7 deficiency leads to increased lysosomal acidity through dysregulated v-ATPase activity .

To assess v-ATPase assembly, proximity ligation assays (PLA) between V0 subunit (e.g., ATP6V0a4) and V1 subunit (e.g., ATP6V1B1) have proven particularly effective. Since functional v-ATPase requires association of these domains, PLA puncta quantification provides a direct measure of assembled complexes. The research demonstrates that NKG7 expression reduces the number of PLA puncta within cells, indicating fewer instances of V0-V1 assembly . Complementary to this approach, membrane fractionation followed by western blotting to analyze V1 domain recruitment to membranes has shown that NKG7 expression reduces the presence of V1 domain subunits in membrane fractions, while NKG7 knockout increases membrane levels of V1 domain subunits .

For functional assessment of v-ATPase activity, researchers can use specific inhibitors (BafA1, concanamycin A, salicylihalamide A) as positive controls and comparators. Treatment with BafA1, for instance, reversed the phenotypes observed in NKG7-knockout CD8+ T cells, confirming the mechanistic connection between NKG7 deficiency and increased v-ATPase activity . Additional functional readouts include analyses of processes dependent on lysosomal acidification, such as cathepsin processing and activity. Experimental design should incorporate proper controls, including v-ATPase inhibitors and cells with known alterations in lysosomal pH, to ensure reliable interpretation of results.

What approaches should be used to study NKG7's role in CD8+ T cell memory formation?

Investigating NKG7's contribution to memory CD8+ T cell development requires both in vivo and in vitro experimental systems that capture the complex process of memory formation. In vivo infection models represent the gold standard, as they recapitulate the natural context of immune response and memory generation. The research successfully employed lymphocytic choriomeningitis virus (LCMV) infection in mice to demonstrate that NKG7-mediated mTORC1 negative regulation is required for the generation of long-lived CD8+ T cell responses to both acute and chronic viral infections . In these models, researchers should track antigen-specific T cells (using MHC tetramers or adoptively transferred TCR-transgenic cells) through the expansion, contraction, and memory phases of the response.

Mechanisms connecting NKG7 to memory formation appear to operate through mTORC1 regulation. Hyperactive mTORC1 activity found in NKG7-knockout CD8+ T cells from LCMV-infected mice was reversed with BafA1 treatment, indicating that increased v-ATPase activity drives enhanced mTORC1 signaling in the absence of NKG7 . Since excessive mTORC1 activity promotes terminal effector differentiation at the expense of memory precursor development, this provides a mechanistic link between NKG7 expression and memory capacity.

Phenotypic and functional analysis should include comprehensive assessment of memory markers (CD127, CD62L, KLRG1), metabolic profiles (mitochondrial mass, spare respiratory capacity), transcription factor expression (T-bet, Eomes, TCF1), and recall potential upon reinfection or secondary stimulation. The kinetics of the response should be carefully tracked, as effects on memory formation may not be apparent during the early effector phase. Secondary and memory precursor markers (particularly IL-7Rα, CXCR3, and CD27) should be evaluated during the effector phase to identify early signs of altered memory potential in NKG7-manipulated cells.

How should researchers approach NKG7 expression analysis in human clinical samples?

Analyzing NKG7 expression in human clinical samples requires careful consideration of technical and biological factors to ensure meaningful results. Sample preparation represents a critical first step, with different approaches suited to different analyses. For protein-level detection, immunofluorescence staining of tissue sections has proven effective, allowing visualization of NKG7 expression within the tissue context . This approach successfully identified CD8+ T cells with varying levels of NKG7 expression in intracellular granules within bladder cancer specimens . Flow cytometry offers a complementary approach for dissociated samples, providing quantitative assessment of NKG7 expression alongside markers of cell type, activation status, and functional capacity.

Expression scoring systems should be carefully standardized to ensure reproducibility. The research successfully stratified patients based on NKG7 expression levels (negative/low versus medium/high) in tumor-infiltrating T cells, which correlated significantly with clinical outcomes . When developing such scoring systems, researchers should establish clear criteria for positivity, ideally using digital image analysis to reduce subjective interpretation. Co-staining with cell type markers (CD8 for T cells, CD56 for NK cells) is essential to distinguish NKG7 expression in different immune populations.

What approaches can be used to target NKG7 function for therapeutic purposes?

While the search results don't directly address therapeutic targeting of NKG7, the protein's established functions suggest several potential strategies for translational applications. Given NKG7's role as a negative regulator of mTORC1 and enhancer of cytotoxic function, therapeutic approaches might aim to modulate its expression or activity depending on the disease context. For cancer immunotherapy, enhancing NKG7 expression or function in tumor-reactive CD8+ T cells could potentially improve anti-tumor responses. This is supported by findings that CD8+ T cell-specific overexpression of NKG7 in mice led to increased tumor-infiltrating lymphocytes, enhanced cytokine production, and improved anti-tumor immunity .

Several therapeutic modalities could be considered:

  • Cell therapy approaches: Engineering adoptive T cell products (such as TILs or CAR-T cells) with optimized NKG7 expression could enhance their persistence and tumor-infiltrating capacity. The research demonstrated that overexpression of NKG7 enhanced the delivery or trafficking of lytic granules without affecting their contents, suggesting this approach might improve cytotoxic function while maintaining specificity .

  • Small molecule modulators: Compounds that stabilize NKG7 protein or enhance its interaction with v-ATPase components could potentially augment its regulatory functions. Conversely, in contexts where enhanced mTORC1 activity might be beneficial, inhibitors of NKG7-v-ATPase interaction could be developed.

  • Biomarker applications: The strong correlation between NKG7 expression and positive clinical outcomes suggests its potential utility as a biomarker for patient stratification. Patients with low NKG7 expression in tumor-infiltrating lymphocytes might benefit from more aggressive therapy or specific immunotherapy approaches.

Any therapeutic targeting approach would require careful consideration of NKG7's cell type-specific expression and multiple biological functions. Potential off-target effects on memory formation versus immediate cytotoxic function would need to be carefully balanced depending on the disease context and therapeutic goals.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.