Recombinant Mouse Protein odr-4 homolog (Odr4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
Odr4; Protein odr-4 homolog; mODR-4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-447
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Odr4
Target Protein Sequence
MGRTYIVEETVGQYLSSINLQGKPFVSGLLIGQCSSQKDYVILATRTPPKEEQNDKVKQP RAKLDNLDEEWATEHASQVSRMLPGGLVVLGIFIITTLELADDFQNALRRLIFSMEKSMS RKRLWDVTEDEVSERVTLHICSSTKKISCRTYDVQDPKSSARPADWKYQSRVSASWLSLD CTVHVNIHIPLSATSVSYTLEKNTKSGLTRWAKQIENGVYLINGQVKGNDCDLLEGQKKS RGNTQATAHSFDVRVLTQLLLNSDHRSTATVQICSGSVNLRGNVKCRAYIHSNRPKVKDA VQAVKRDILNTVADRCEILFEDLLLNEIPEKKNYELPQRVFVPLPGSTVMLCDYKFGDES AEEIRDHFSEMLDHEIQIEDLEIAEEVNTACMTSSVNSEASLTNTSEEQPEQPKKTIGVK IQQNIGVIAALAVAVLAAGISFHYFSD
Uniprot No.

Target Background

Function
Plays a potential role in the trafficking of a subset of G-protein coupled receptors.
Database Links
Protein Families
ODR-4 family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Ubiquitously expressed.

Q&A

What is the functional role of Odr4 protein in cellular systems?

Odr4 protein plays a critical role in the localization and trafficking of G protein-coupled receptors (GPCRs), particularly odorant receptors. Based on studies in C. elegans and mammalian systems, Odr4 forms an endoplasmic reticulum (ER) complex with other proteins such as ODR-8/Ufm1 Specific Protease 2 to promote GPCR maturation through a Ufm1-independent mechanism .

Specifically, Odr4 is required for the proper localization of a subset of 7-transmembrane domain odorant receptors to the cilia of olfactory neurons . This function is essential for normal olfactory responses, as disruption of Odr4 can lead to odorant response abnormalities. Gene ontology annotations indicate that Odr4 is involved in protein localization pathways .

How should Recombinant Mouse Odr4 protein be stored and handled in the laboratory?

For optimal stability and activity of Recombinant Mouse Odr4 protein, follow these storage and handling guidelines:

  • Long-term storage: Store the lyophilized powder at -20°C/-80°C upon receipt .

  • Reconstitution: Before opening, briefly centrifuge the vial to bring contents to the bottom. Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

  • Post-reconstitution storage: Add glycerol to a final concentration of 50% (or 5-50% as needed) and make aliquots for long-term storage at -20°C/-80°C .

  • Working conditions: Store working aliquots at 4°C for up to one week. Avoid repeated freeze-thaw cycles as they can compromise protein integrity .

  • Buffer conditions: The protein is typically provided in Tris/PBS-based buffer with 6% Trehalose at pH 8.0 .

The purity of commercially available recombinant Odr4 protein is typically greater than 90% as determined by SDS-PAGE .

What experimental designs are optimal for studying Odr4's role in GPCR localization and trafficking?

When designing experiments to investigate Odr4's role in GPCR localization and trafficking, consider the following approaches:

Immunoprecipitation-based interaction studies:
Implement co-immunoprecipitation experiments to identify interaction partners of Odr4. Based on previous studies, design experiments with tagged versions of Odr4 (e.g., ODR-4-FLAG) co-expressed with potential partners (e.g., HA-ODR-8 and ODR-10-GFP) to pull down protein complexes . This approach has been successful in revealing that ODR-4, ODR-8, and ODR-10 form a complex at the ER.

Immunocytochemistry for subcellular localization:

  • Transfect cells (e.g., HeLa) with tagged Odr4 constructs (ODR-4b-FLAG)

  • After 3 days, fix cells and perform immunostaining with appropriate antibodies

  • Use co-staining with ER markers (e.g., TRAPα) to confirm localization

  • Apply semi-permeabilization techniques with digitonin to distinguish between cytoplasmic and membrane-associated proteins

Functional assays for GPCR maturation:
Design experiments that measure:

  • GPCR surface expression levels with and without Odr4 co-expression

  • Functional response of GPCRs using calcium flux assays or cAMP measurements

  • Trafficking rates of GPCRs from ER to plasma membrane

When designing these experiments, consider implementing the following experimental controls:

Control TypePurposeImplementation
Negative ControlVerify specificity of interactionsUse non-related proteins with same tags
Overexpression ControlAccount for artifacts due to overexpressionInclude native expression level controls
Knockdown/Knockout ControlConfirm function in loss-of-function contextsiRNA, shRNA, or CRISPR against Odr4
Domain Mutation ControlsMap functional domainsCreate point mutations or deletion constructs

How can gene expression experimental design be optimized when studying Odr4?

When designing gene expression studies for Odr4, follow these methodological approaches for optimal results:

  • Sample preparation and RNA extraction:

    • Carefully select appropriate tissues (e.g., olfactory epithelium) where Odr4 is naturally expressed

    • Implement strict RNA handling protocols to avoid degradation

    • Use appropriate extraction methods that yield high-quality, inhibitor-free RNA

  • qPCR assay design:

    • Design primers that span exon-exon junctions to avoid genomic DNA amplification

    • Consider the presence of Odr4 transcript variants and ensure primers target conserved regions

    • Perform BLAST analysis to confirm primer specificity

    • Check for SNPs in primer binding regions that could affect amplification efficiency

  • Reference gene selection:

    • Rather than relying solely on traditional reference genes like GAPDH or ACTB, evaluate multiple reference genes for stability in your specific experimental context

    • Use at least two reference genes for normalization

    • Validate reference gene stability using tools like geNorm or NormFinder

  • Controls and replicates:

    • Include both technical and biological replicates

    • Implement no-template controls and no-RT controls

    • Consider including serial dilutions to establish a standard curve and determine assay efficiency

  • Data analysis approaches:

    • For low abundance targets like potentially rare Odr4 transcripts, consider using digital PCR instead of qPCR for absolute quantification without reliance on standard curves

    • Apply appropriate statistical methods based on your experimental design (e.g., ANOVA for multiple group comparisons)

Following these guidelines will help generate reliable gene expression data for Odr4, particularly in contexts where expression levels may be low or tissue-specific.

What methodological approaches can be used to investigate Odr4's role in an ER complex promoting GPCR maturation?

To study Odr4's role in ER complex formation and GPCR maturation, consider these methodological approaches:

1. Biochemical Fractionation and Co-localization:

  • Perform subcellular fractionation to isolate ER membranes

  • Use density gradient centrifugation to separate ER subdomains

  • Analyze co-localization of Odr4 with ER markers and GPCR cargo using Western blotting

  • Apply immunofluorescence microscopy with markers for ER exit sites, ERGIC, and Golgi compartments

2. Protein-Protein Interaction Analysis:

  • Implement proximity labeling approaches (BioID, APEX) with Odr4 as the bait

  • Use FRET/BRET assays to study dynamic interactions between Odr4 and GPCRs in living cells

  • Apply crosslinking mass spectrometry to map interaction interfaces

  • Consider split-GFP complementation assays to visualize interactions in specific cellular compartments

3. Functional GPCR Trafficking Assays:

  • Utilize RUSH (Retention Using Selective Hooks) system to synchronize and track GPCR trafficking

  • Implement surface biotinylation assays to quantify plasma membrane delivery of GPCRs

  • Apply FRAP (Fluorescence Recovery After Photobleaching) to measure mobility of GPCRs in presence/absence of Odr4

  • Use temperature-sensitive trafficking blocks (e.g., 15°C, 20°C blocks) to dissect specific steps in the secretory pathway

4. Structure-Function Analysis:

  • Generate domain deletion constructs of Odr4 to map regions essential for GPCR interaction

  • Create chimeric proteins between mouse and C. elegans Odr4 to identify conserved functional domains

  • Implement alanine-scanning mutagenesis of conserved residues

5. In vivo models:

  • Develop conditional knockout mouse models of Odr4 in specific tissues

  • Assess olfactory function through behavioral tests

  • Analyze GPCR localization in olfactory neurons using immunohistochemistry

  • Perform electrophysiological recordings to assess functional outcomes of Odr4 disruption

How can researchers address data inconsistencies in Odr4 functional studies between different model systems?

When encountering contradictory data regarding Odr4 function across different model systems (e.g., C. elegans vs. mouse vs. cell culture), implement these methodological approaches:

This structured approach can help resolve contradictions by identifying whether differences are due to biological divergence of Odr4 function or methodological variables.

What are the optimal experimental designs for studying protein-protein interactions involving Odr4?

When designing experiments to study Odr4's protein-protein interactions, consider the following comprehensive approach:

1. Experimental Design Planning:
Begin with clear hypothesis formulation and systematic variable identification:

  • Define independent variables (e.g., Odr4 expression levels, mutations, cell types)

  • Establish dependent variables (e.g., interaction strength, subcellular localization)

  • Control for extraneous variables (e.g., expression levels of interaction partners)

The experimental design should follow these steps:

  • Define variables and their relationships

  • Formulate specific, testable hypotheses

  • Design experimental treatments to manipulate independent variables

  • Plan appropriate controls

  • Establish measurement protocols for dependent variables

2. Interaction Detection Methods:

MethodStrengthsLimitationsBest Application
Co-immunoprecipitationDetects native complexesMay miss transient interactionsStable complexes in cell lysates
Proximity labeling (BioID, APEX)Captures transient/weak interactionsRequires genetic modificationInteraction networks in living cells
FRET/BRETReal-time dynamics in living cellsComplex setup and analysisDynamic interactions in intact cells
Yeast two-hybridHigh-throughput screeningHigh false positive rateInitial interaction discovery
Pull-down assaysTests direct interactionsUses recombinant proteinsConfirming direct binding

3. Validation Through Multiple Approaches:
Confirm interactions using at least two orthogonal methods. For example:

  • Initial detection with co-immunoprecipitation (as shown in Figure 8 from search result )

  • Confirmation with immunofluorescence co-localization

  • Functional validation through mutagenesis of interaction interfaces

4. Controls for Interaction Specificity:
Include appropriate controls to ensure interaction specificity:

  • Test interactions with structurally similar but functionally distinct proteins

  • Include tag-only controls when using tagged proteins

  • Test interaction dependency on specific domains through truncation constructs

5. Quantification and Statistical Analysis:

  • Use quantitative methods to measure interaction strength (e.g., co-IP band intensity ratios)

  • Implement appropriate statistical tests based on experimental design

  • Include biological replicates to account for natural variation

By implementing this structured experimental design approach, researchers can generate robust and reproducible data on Odr4's protein-protein interactions, which is essential for understanding its role in GPCR trafficking and maturation.

What methods are available for detecting and quantifying Recombinant Mouse Odr4 protein in experimental samples?

Several analytical methods are available for detecting and quantifying Recombinant Mouse Odr4 protein:

1. Immunological Methods:

  • Western Blotting: Using anti-Odr4 or anti-tag (e.g., anti-His) antibodies. Typically detects denatured Odr4 with sensitivity in the nanogram range .

  • ELISA: Enzyme-linked immunosorbent assays using specific antibodies against Odr4 or epitope tags. Commercial ELISA kits for Mouse Odr4 are available with detection ranges of approximately 0.156-10 ng/ml .

  • Immunoprecipitation: Can be used to isolate Odr4 from complex mixtures before detection .

  • Immunofluorescence: For detecting cellular localization using fluorescently-labeled antibodies against Odr4 or epitope tags .

2. Mass Spectrometry-Based Approaches:

  • Shotgun Proteomics: For identification and relative quantification

  • Targeted MS (MRM/PRM): For absolute quantification of specific Odr4 peptides

  • MALDI-TOF: For molecular weight confirmation of purified protein

3. Tag-Based Detection Methods:
For recombinant Odr4 with fusion tags:

  • His-tag detection: Using anti-His antibodies or Ni-NTA conjugated detection reagents

  • FLAG-tag detection: When using FLAG-tagged constructs

  • Fluorescent protein fusions: Direct visualization of GFP/RFP-tagged Odr4

4. Activity-Based Detection:

  • Functional assays: Measuring GPCR trafficking efficiency as an indirect measure of Odr4 activity

  • Binding assays: Detecting Odr4 through its interaction with known binding partners

Selection Criteria for Detection Method:

ConsiderationOptionsRecommendation
Sample typePurified protein vs. cell lysate vs. tissueWestern blot for lysates/tissues; ELISA for purified protein
Sensitivity neededng/ml vs. pg/mlStandard Western blot (ng range); ELISA or MS (pg range)
QuantificationRelative vs. absoluteWestern blot for relative; ELISA or MS for absolute
High-throughputYes/NoELISA for multiple samples; automated Western platforms
Structural informationYes/NoNative PAGE or crosslinking MS for structural insights

When selecting a method, consider the specific experimental question, required sensitivity, and available resources.

How can researchers troubleshoot expression and purification issues with Recombinant Mouse Odr4 protein?

When encountering challenges with expression and purification of Recombinant Mouse Odr4 protein, implement this systematic troubleshooting approach:

1. Expression System Selection Issues:

IssuePotential CauseSolution
Low expression yieldInappropriate host systemTry alternative systems (bacterial, yeast, insect, mammalian)
Protein insolubilityImproper folding in bacterial systemsConsider eukaryotic expression systems like baculovirus
Toxicity to hostMembrane protein expression burdenUse tightly regulated inducible promoters; lower induction temperature
Inconsistent expressionPlasmid instabilityCheck for recombination; sequence verify before large-scale expression

2. Optimization of Expression Conditions:

  • Temperature: Test lower temperatures (16-25°C) to improve folding

  • Induction timing: Induce at different cell densities

  • Induction strength: Titrate inducer concentration

  • Media composition: Test enriched media or supplementation with specific cofactors

  • Co-expression strategies: Consider co-expressing chaperones or binding partners

3. Purification Troubleshooting:

  • Low binding to affinity resin:

    • Verify tag accessibility; consider moving tag to opposite terminus

    • Check pH and buffer conditions; adjust based on theoretical pI of Odr4

    • Test different detergents if membrane association is suspected

  • Impurities/Contaminants:

    • Implement additional purification steps (ion exchange, size exclusion)

    • Consider on-column washing with low concentrations of denaturants

    • Test different elution conditions to minimize co-eluting proteins

  • Protein degradation:

    • Add protease inhibitors throughout purification

    • Reduce purification time and temperature

    • Test stability in different buffer compositions

4. Protein Quality Assessment:

  • Aggregation: Perform dynamic light scattering or size exclusion chromatography

  • Proper folding: Use circular dichroism to assess secondary structure

  • Functionality: Develop binding or activity assays to confirm biological activity

  • Stability: Monitor protein stability at different temperatures and buffer conditions

5. Special Considerations for Odr4:

  • Odr4 may have hydrophobic regions (suggested by its role in membrane protein trafficking), consider adding mild detergents

  • If association with the ER is maintained in recombinant systems, extraction conditions may need optimization

  • Consider whether post-translational modifications present in mammalian systems are required for function

By systematically addressing these aspects, researchers can overcome challenges in producing high-quality Recombinant Mouse Odr4 protein for functional and structural studies.

What are emerging research questions about Odr4's role in cellular systems beyond olfactory neurons?

As research on Odr4 progresses, several promising directions are emerging for investigating its functions beyond olfactory neurons:

  • GPCR trafficking in non-olfactory neurons:

    • Does Odr4 participate in trafficking of non-odorant GPCRs in other neuronal populations?

    • Could Odr4 play a role in synaptic plasticity through regulation of neurotransmitter receptor localization?

    • How does Odr4 expression correlate with neuronal activity and receptor turnover?

  • Potential roles in non-neuronal tissues:

    • Investigation of Odr4 expression patterns across different tissue types using single-cell RNA sequencing data

    • Functional studies in tissues with high GPCR-dependent signaling (e.g., immune cells, endocrine tissues)

    • Potential roles in development and cellular differentiation where GPCR signaling is critical

  • Disease relevance and therapeutic potential:

    • Analysis of Odr4 mutations or expression changes in diseases with aberrant GPCR trafficking

    • Exploration of Odr4 as a potential drug target for modulating GPCR surface expression

    • Investigation of Odr4 roles in cancer progression where GPCR signaling is often dysregulated

  • Structural biology approaches:

    • Determination of Odr4's three-dimensional structure using cryo-EM or X-ray crystallography

    • Mapping of interaction domains for different GPCR partners

    • Structure-guided design of molecules that could modulate Odr4-mediated GPCR trafficking

  • Systems biology perspective:

    • Integration of Odr4 into larger protein interaction networks involved in secretory pathway quality control

    • Computational modeling of how Odr4 expression levels affect GPCR homeostasis

    • Multi-omics approaches to identify regulatory mechanisms controlling Odr4 expression

These research directions will benefit from advanced experimental designs that integrate multiple methodological approaches and model systems to build a comprehensive understanding of Odr4's broader biological functions.

How might advanced experimental approaches enhance our understanding of Odr4's molecular mechanisms?

Emerging experimental technologies offer new opportunities to elucidate Odr4's molecular mechanisms:

1. Single-molecule approaches:

  • Single-molecule FRET to track conformational changes during Odr4-GPCR interactions

  • Super-resolution microscopy (STORM, PALM) to visualize Odr4-mediated trafficking events at nanoscale resolution

  • Optical tweezers or atomic force microscopy to measure binding forces between Odr4 and its partners

2. Advanced genetic manipulation techniques:

  • CRISPR-Cas9 base editing for precise mutation of endogenous Odr4

  • Conditional and cell-type-specific knockout models using Cre-lox systems

  • CRISPR activation/inhibition systems to modulate Odr4 expression levels without genetic modification

3. Integrative structural biology:

  • Cryo-electron tomography of cellular sections to visualize Odr4 complexes in their native environment

  • Integrative modeling combining data from X-ray crystallography, NMR, crosslinking-MS, and AlphaFold predictions

  • Hydrogen-deuterium exchange mass spectrometry to map dynamic protein-protein interaction interfaces

4. High-throughput functional screens:

  • CRISPR screens to identify synthetic lethal or synthetic rescue interactions with Odr4

  • Barcoded GPCR libraries to identify specificity determinants for Odr4-dependent trafficking

  • Chemogenomic screens to find small molecules that modulate Odr4 function

5. In situ techniques:

  • Proximity labeling (TurboID, APEX) in specific cellular compartments to map spatial interaction networks

  • Live-cell tracking of Odr4 and cargo using lattice light sheet microscopy

  • Correlative light and electron microscopy to link Odr4 dynamics to ultrastructural features

6. Organ-on-chip or organoid systems:

  • Development of olfactory epithelium organoids to study Odr4 in a physiologically relevant context

  • Microfluidic systems to analyze odorant responses in engineered neurons with modified Odr4

By integrating these advanced approaches, researchers can build a comprehensive understanding of how Odr4 functions at the molecular level, ultimately providing insights into fundamental mechanisms of GPCR trafficking and potential therapeutic applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.