Recombinant Mouse Protein reprimo (Rprm)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
Rprm; Protein reprimo
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-109
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MNSVLGNQTDVAGLFLVNSSEALERAVRCCTQASVVTDDGFAEGGPDERSLYIMRVVQIA VMCVLSLTVVFGIFFLGCNLLIKSEGMINFLVKDRRPSKEVEAVVVGPY
Uniprot No.

Target Background

Function
Reprimo (RPRM) may regulate p53-dependent G2 cell cycle arrest. It appears to induce cell cycle arrest by inhibiting CDK1 activity and the nuclear translocation of the CDC2-cyclin B1 complex.
Gene References Into Functions
  1. RPRM is transiently upregulated post-transcriptionally during cellular stress to limit cell survival, proliferation, and tumor formation. PMID: 22562171
  2. Induction by DNA damage and hypoxia suggests IGFBP-3's role in protecting against aberrant cell growth. PMID: 15769996
  3. Post-UVB treatment, green tea or topical caffeine accelerated the regression of mutant p53-positive skin patches in hairless mice. PMID: 15817611
  4. p53(R273H) directly binds to the relaxin promoter, supporting a role for H2 relaxin signaling in p53(R273H)-mediated androgen-independent prostate cancer. PMID: 16434975
  5. Mitochondrial targeting of p53 confers a growth disadvantage in B-lymphomas expressing various p53 point mutants, inducing efficient apoptosis in vitro and in vivo. PMID: 16682948
  6. In p53-null cells, a specific peptide derepresses p73, triggering p73-mediated gene activation and cell death. Transgene expression of this peptide induced tumor formation. PMID: 17347683
  7. tp53 activation occurs post-translationally via chloroquine-dependent phosphorylation of ATM, leading to ATM-dependent phosphorylation of tp53 kinase and mediating resistance to mammary carcinogenesis. PMID: 18089834
  8. p53-deficient mice showed less spermatogenesis degeneration compared to single jsd mutants. PMID: 18356279
Database Links
Protein Families
Reprimo family
Subcellular Location
Cytoplasm. Membrane; Single-pass membrane protein.

Q&A

What is Reprimo (RPRM) and what are its primary functions?

Reprimo (RPRM) is a tumor suppressor gene involved in the regulation of p53-mediated cell cycle arrest at G2/M phase. It plays a crucial role in DNA damage repair and has been associated with malignant tumor progression . RPRM has recently been identified as a potential preventive and therapeutic target for radiation-induced brain injury through multiple mechanisms . In humans, the canonical protein has a reported length of 109 amino acid residues and a mass of 11.8 kDa . Physiologically, RPRM may be essential for brain development and function, as it shows abundant expression in brain tissues .

How is RPRM structurally characterized?

Protein analysis of RPRM reveals a striking conservation of the C-terminus across species, while the N-terminus domain retains the most variability within the protein family. The protein contains a short region of approximately 20 amino acids forming a potential transmembrane domain. Specific amino acid differences distinguish RPRM from related family members RPRML and RPRM3, with aspartic acid (D), methionine (M), and glycine (G) at conserved sites being characteristic of RPRM . Multiple sequence alignment techniques such as the L-INS-i strategy from MAFFT v.7 can be used to identify these distinguishing features, and potential domains can be predicted using methods like TMHMM .

What is the expression pattern of RPRM in different tissues?

RPRM is variably expressed across different tissues, with the brain being one of the organs showing the most abundant expression . Research in zebrafish has demonstrated that rprm (rprma/rprmb) and rprml are expressed in the notochord, brain, blood vessels, and digestive tube after one day post-fertilization, while rprm3 shows a unique expression profile restricted to the central nervous system (CNS) . Importantly, tissue-specific expression patterns of RPRM transcripts and protein are conserved between zebrafish and humans, suggesting evolutionary conservation of function . This expression pattern can be studied using techniques such as RT-qPCR, whole-mount in situ hybridization (WISH), and immunohistochemistry (IHC) staining .

What are the best methods for detecting RPRM expression in tissue samples?

For comprehensive analysis of RPRM expression in tissue samples, a multi-technique approach is recommended:

  • RT-qPCR: For RNA expression analysis, use gene-specific primer sets for RPRM. In zebrafish studies, the following primers have been validated: forward primer 5'-AACCAAACGGACAGTGGCATCT-3' and reverse primer 5'-AAGACTACGGTGAGGGAAAGCA-3' . Expression should be normalized against suitable reference genes (e.g., actb1 in zebrafish).

  • In Situ Hybridization: WISH and FISH can be performed using cRNA probes synthesized from the 5' untranslated regions to minimize cross-reactivity with other family members. Templates for probe synthesis can be PCR amplified from cDNA using primers that include T7 RNA polymerase promoter sequence .

  • Immunohistochemistry: Anti-RPRM antibodies targeted to specific epitopes (e.g., Anti-RPRM (38-50) antibody) can be used with visualization systems like Vectastain Elite Kit to detect protein expression in tissue sections .

How can researchers generate recombinant mouse RPRM for experimental studies?

For generating recombinant mouse RPRM:

  • Clone the full-length mouse RPRM cDNA into an appropriate expression vector containing a strong promoter (e.g., CMV) and a purification tag (e.g., His-tag or GST-tag).

  • Express the recombinant protein in a mammalian expression system (e.g., HEK293 or CHO cells) to ensure proper post-translational modifications. Bacterial expression systems may be used but might not provide proper folding due to the transmembrane domain identified in RPRM .

  • Purify the recombinant protein using affinity chromatography based on the fusion tag.

  • Confirm protein identity and purity through Western blotting using anti-RPRM antibodies and mass spectrometry to verify the expected mass of 11.8 kDa.

  • For functional studies, consider removing the purification tag if it might interfere with protein function, especially considering the important C-terminal conservation of RPRM .

How does RPRM regulate the cell cycle and what experimental models best demonstrate this function?

RPRM functions as a regulator of p53-mediated cell cycle arrest at G2/M phase . To experimentally demonstrate this function:

  • Cell Cycle Analysis: Treat cells with DNA-damaging agents (e.g., radiation, etoposide) and analyze cell cycle distribution using flow cytometry with propidium iodide staining. Compare wild-type cells with RPRM-knockdown or knockout cells to observe differences in G2/M arrest.

  • Checkpoint Activation: Examine the phosphorylation status of checkpoint proteins (e.g., CDC2, Cyclin B1) by Western blotting following DNA damage in the presence or absence of RPRM.

  • RPRM Induction: Monitor RPRM expression levels after DNA damage using RT-qPCR or Western blotting to establish the temporal relationship between damage and RPRM upregulation .

  • Animal Models: RPRM knockout mouse models can be particularly valuable, as recent studies have demonstrated that RPRM deletion significantly affects radioresistance in mice . The zebrafish model has also been validated for studying RPRM family members in vivo .

What are the methodological challenges in studying RPRM as a tumor suppressor gene?

Studying RPRM as a tumor suppressor presents several methodological challenges:

  • Low Baseline Expression: In many cell types, RPRM expression may be low under normal conditions and only induced upon DNA damage, requiring sensitive detection methods.

  • Isoform Specificity: Due to the presence of RPRM family members (RPRM, RPRML, RPRM3) and potential splice variants, careful primer and antibody design is essential to ensure specificity .

  • Epigenetic Regulation: RPRM expression may be silenced through epigenetic mechanisms in certain cancers, necessitating epigenetic profiling (e.g., methylation analysis) alongside expression studies.

  • Functional Redundancy: Potential functional overlap between RPRM family members may complicate knockout studies, suggesting the value of double or triple knockout models .

  • Context-Dependent Effects: RPRM may have different functions in different tissues, as suggested by its variable expression pattern, requiring tissue-specific conditional knockout models .

How can researchers leverage RPRM knockout models to study radiation-induced brain injury mechanisms?

RPRM knockout (KO) mouse models have revealed that RPRM deletion alleviates radiation-induced brain injury through multiple mechanisms . To effectively study these mechanisms:

  • Establish Appropriate Controls: Compare age and sex-matched RPRM KO and wild-type mice exposed to whole-brain irradiation (WBI) using standardized protocols.

  • Assess DNA Damage: Quantify γ-H2AX foci in hippocampal tissues following WBI to measure DNA damage levels. Recent research has shown that RPRM knockout significantly reduces hippocampal DNA damage and apoptosis shortly after radiation exposure .

  • Evaluate Neuroinflammation: Measure inflammatory cytokines and microglial activation markers in brain tissues at multiple time points post-irradiation.

  • Monitor Oxidative Stress: Measure markers of oxidative stress such as reactive oxygen species (ROS) levels, lipid peroxidation, and antioxidant enzyme activities.

  • Assess Cognitive Function: Perform behavioral tests (e.g., Morris water maze, novel object recognition) to correlate molecular changes with functional outcomes.

  • Investigate ATM Pathway: Examine the ataxia–telangiectasia-mutated (ATM) protein kinase pathway, as RPRM has been shown to negatively regulate ATM .

What experimental approaches can distinguish the functions of different RPRM family members?

To distinguish the functions of RPRM, RPRML, and RPRM3:

  • Spatiotemporal Expression Analysis: Use techniques like WISH, FISH, and RT-qPCR to map the expression patterns of each family member during development and in adult tissues. Previous research has shown distinct expression patterns, with RPRM3 being exclusively expressed in the CNS in zebrafish .

  • Single and Combined Knockouts: Generate single, double, and triple knockout models to identify unique and redundant functions. The zebrafish model is particularly valuable due to its retention of all three family members .

  • Domain Swapping: Create chimeric proteins by swapping domains between family members to identify which regions are responsible for specific functions.

  • Protein-Protein Interaction Studies: Perform immunoprecipitation followed by mass spectrometry to identify interaction partners specific to each family member.

  • Rescue Experiments: Test whether one family member can rescue the phenotypes caused by the deletion of another to assess functional redundancy.

How can RPRM be utilized as a biomarker for early cancer detection?

RPRM has been associated with malignant tumor progression and proposed as a potential biomarker for early cancer detection . To develop RPRM as a cancer biomarker:

  • Tissue-Specific Expression Profiling: Compare RPRM expression levels between normal, premalignant, and malignant tissues using RT-qPCR and IHC to establish baseline expression and disease-associated changes .

  • Methylation Analysis: Examine RPRM promoter methylation status, as epigenetic silencing of RPRM may serve as an early event in carcinogenesis.

  • Secreted/Circulating RPRM: Investigate whether RPRM can be detected in body fluids (serum, urine) using sensitive ELISA or digital PCR techniques, which would facilitate non-invasive testing.

  • Correlation with Disease Progression: Conduct longitudinal studies to correlate RPRM levels or methylation status with disease outcomes to establish prognostic value.

  • Multimarker Panels: Combine RPRM with other biomarkers to improve sensitivity and specificity for early cancer detection.

What approaches should researchers take to investigate RPRM as a therapeutic target for radiation-induced brain injury?

Recent research has identified RPRM as a potential preventive and therapeutic target for radiation-induced brain injury . To investigate this potential:

  • Pharmacological Modulation: Screen for compounds that can inhibit RPRM expression or function using high-throughput screening approaches.

  • Targeted Delivery: Develop methods for targeted delivery of RPRM inhibitors to the brain, such as nanoparticle-based delivery systems or brain-penetrant small molecules.

  • Timing of Intervention: Determine the optimal timing for RPRM inhibition in relation to radiation therapy by administering treatments at different time points before or after radiation.

  • Combination Therapies: Test RPRM inhibition in combination with other neuroprotective strategies to identify synergistic effects.

  • Long-term Outcomes: Assess both short-term and long-term outcomes of RPRM inhibition after radiation exposure, including cognitive function, neuroinflammation, and cellular damage.

  • Mechanism Delineation: Investigate the downstream pathways affected by RPRM inhibition, particularly focusing on the ATM kinase pathway which has been implicated in RPRM's function in DNA damage repair .

How conserved is RPRM across species and what does this reveal about its fundamental biological roles?

Phylogenetic analysis reveals that RPRM and RPRML have been differentially retained by most species throughout vertebrate evolution, while RPRM3 has been retained only in a small group of distantly related species, including zebrafish . This conservation pattern provides insights into fundamental biological roles:

  • Sequence Conservation: High-level conservation (72.5% and 66% identity between human RPRM and zebrafish rprma, rprmb, and rprm3 proteins; 55.7% identity between human and zebrafish RPRML proteins) suggests functionally important domains have been maintained .

  • Expression Conservation: Tissue-specific expression patterns of RPRM are strikingly conserved between zebrafish and humans, suggesting conserved regulatory mechanisms and functions .

  • Functional Inference: The strong conservation of the C-terminus across species suggests this region is critical for protein function, while the variability in the N-terminus may confer species or tissue-specific functions .

  • Developmental Roles: The expression of rprmb primarily during developmental phases in zebrafish, with loss in adults, suggests specialized developmental functions that may be conserved in mammalian RPRM .

What methodological considerations are important when using zebrafish as a model for RPRM research?

The zebrafish has been validated as a powerful tool for studying RPRM family members . Important methodological considerations include:

  • Gene Duplication: Unlike mammals, zebrafish possess a duplication of RPRM (rprma and rprmb), requiring careful experimental design to address potential functional redundancy .

  • Developmental Timing: Different RPRM family members show distinct temporal expression patterns during development. For example, rprmb is expressed in somites at early developmental stages, while later expression includes the notochord, brain, blood vessels, and digestive tube .

  • Probe and Primer Design: Due to gene duplication and the presence of multiple family members, careful design of specific probes and primers is essential. The 5' untranslated regions can be targeted to minimize cross-reactivity .

  • Method Selection: Different techniques provide complementary information about RPRM expression:

    • WISH provides spatial information during development

    • FISH offers cellular resolution

    • RT-qPCR provides quantitative expression data

    • IHC reveals protein localization

  • Translational Relevance: When extrapolating results from zebrafish to mammals, consider both the conserved aspects (expression patterns, protein structure) and the differences (gene duplication, developmental timing) .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.