Recombinant Mouse Protein RER1 (Rer1)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If a specific tag type is required, please inform us, and we will prioritize its development.
The tag type is determined during the production process. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
Rer1; Protein RER1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-196
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Rer1
Target Protein Sequence
MSEGDSVGDSVHGKPSVVYRFFSRLGQIYQSWLDKSTPYTAVRWVVTLGLSFVYMIRVYL
LQGWYIVTYALGIYHLNLFIAFLSPKVDPSLMEDSDDGPSLPTKQNEEFRPFIRRLPEFK
FWHAATKGILVAMICTFFEAFNVPVFWPILVMYFIMLFCITMKRQIKHMIKYRYIPFTHG
KRRYKGKEDVGKTFAS
Uniprot No.
Target Background
Function
RER1 is involved in the retrieval of endoplasmic reticulum membrane proteins from the early Golgi compartment.
Gene References Into Functions
- RER1 regulates the assembly and transport of Nav1.1 and Nav1.6, the primary sodium channels responsible for repetitive firing in Purkinje cells. PMID: 28117367
- RER1 is a crucial factor controlling the surface expression of muscle acetylcholine receptors by localizing unassembled alpha-subunits to the early secretory pathway. PMID: 21187406
Database Links
Protein Families
RER1 family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
