Recombinant Mouse Protein SCAI (Scai)

Shipped with Ice Packs
In Stock

Description

Introduction

Suppressor of Cancer Cell Invasion (SCAI), also known as C9orf126 or NET40, is a protein-coding gene that has been identified to play a crucial role in various cellular processes, including DNA repair, genome stability, and regulation of cell migration . Research indicates that SCAI is involved in both non-homologous end-joining (NHEJ) and homologous recombination (HR)-mediated pathways, which potentiate DNA double-strand break (DSB) repair efficiency in specific chromatin contexts . Furthermore, SCAI's function in DNA interstrand crosslink (ICL) repair via the Fanconi anemia (FA) pathway highlights its importance in maintaining genomic integrity .

General Information

The SCAI gene, with Entrez Gene ID 286205, encodes a protein that regulates cell migration and functions in the RhoA-Dia1 signal transduction pathway . It has been associated with diseases such as spinocerebellar ataxia and thrombophilia .

Role in DNA Repair

SCAI plays a significant role in DNA double-strand break (DSB) repair. DSBs are cytotoxic lesions that require accurate repair by NHEJ or HR to maintain genome integrity . SCAI facilitates ATM kinase signaling at DSBs in repressive chromatin environments and promotes 53BP1-dependent repair of heterochromatin-associated DSBs .

  • SCAI interacts with 53BP1 in an IR- and ATM-stimulated manner, promoting the functionality of DSB repair pathways .

  • SCAI accumulates at DSB sites through 53BP1-dependent recruitment to DSB-surrounding chromatin and 53BP1-independent accumulation at resected DSBs .

  • SCAI deficiency leads to reduced DSB repair capacity, hypersensitivity to DSB-inflicting agents, and genome instability .

Function in Meiotic Recombination

SCAI is also involved in meiotic recombination, a critical process during germ cell development. Studies in mice have shown that SCAI deficiency results in germ cell loss and subfertility due to impaired retention of the DMC1 recombinase on meiotic chromosomes . This highlights the importance of SCAI in maintaining genomic stability during meiosis.

Involvement in ICL Repair and the FA Pathway

SCAI plays a crucial role in the error-free repair of DNA interstrand crosslinks (ICLs) via the Fanconi anemia (FA) pathway . ICLs are cytotoxic lesions that block DNA replication and transcription, threatening genome integrity . The FA pathway orchestrates ICL repair during DNA replication, with ubiquitylated FANCI-FANCD2 (ID2) marking the activation step that triggers incisions on DNA to unhook the ICL .

  • SCAI forms a complex with polymerase $$ \zeta $$ (Pol$$ \zeta $$) and localizes to ICLs during DNA replication .

  • In the absence of SCAI, HR-mediated ICL repair is defective, leading to deletions and radial chromosomes .

  • SCAI interacts with REV3, a subunit of Pol$$ \zeta $$, and this interaction is required for proper ICL repair .

Interaction with Polymerase $$ \zeta $$ (Pol$$ \zeta $$)

SCAI interacts with all five subunits of the polymerase $$ \zeta $$ (Pol$$ \zeta $$) complex (REV1, REV3, REV7, POLD2, and POLD3) . This interaction is critical for translesion synthesis (TLS), a process that allows DNA replication to bypass DNA lesions . SCAI depletion delays Pol$$ \zeta $$-mediated bypass of peptide adducts, indicating its role in facilitating TLS .

Relevance to Cancer

Given its role as a suppressor of cancer cell invasion, SCAI's involvement in DNA repair and maintenance of genomic stability suggests it may act as a tumor suppressor . Further research into SCAI's function could provide insights into cancer development and potential therapeutic strategies.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its inclusion.
Synonyms
Scai; Protein SCAI; Suppressor of cancer cell invasion protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-606
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Scai
Target Protein Sequence
MVRGARQSQQPRSRLAPRLSGTVEKPPRKRKSRTEFTLKETMSSGGAEDDIPQGERKTVT DFCYLLDKSKQLFNGLRDLPQYGQKQWQSYFGRTFDVYTKLWKFQQQHRQVLDNRYGLKR WQIGEIASKIGQLYYHYYLRTSETSYLNEAFSFYSAIRQRSYYSQVNKEDRPELVVKKLR YYARFIVVCLLLNKMDVVKDLVKELSDEIEDYTHRFNTEDQVEWNLVLQEVAAFIEADPV MVLNDDNTIVITSNRLAETGAPLLEQGMIVGQLSLADALIIGNCNNQVKFSELTVDMFRM LQALEREPMNLASQMNKPGIQEPADKPTRRENPHKYLLYKPTFSQLYTFLAASFKELPAN SVLLIYLSATGVFPTGRSDGEGPYDFGGVLTNSNRDIINGDAIHKRNQSHKEMHCLHPGD LYPFTRKPLFIVVDSSNSVAYKNFTNLFGQPLVCLLSPTAYPKALQDQSQRGSLFTLFLN NPLMAFLFVSGLSSMRRGLWEKCQEYLRKINRDIAQLLTHSRSIDQAFLQFFGDEFLRLL LTRFVFCSATMRMHKAFRETRNYPESYPQLPRDETVENPHLQKHILELASILDVRNIFFE NSMDDY
Uniprot No.

Target Background

Function
SCAI (Suppressor of Cancer Cell Invasion) is a tumor suppressor that inhibits MRTFA-induced SRF transcriptional activity. It may also function in the RhoA-Diaph1 signaling pathway, regulating cell migration through transcriptional control of ITGB1.
Gene References Into Functions
  1. SCAI, a 53BP1-interacting chromatin-associated protein, enhances several DNA double-strand break repair pathways in mammalian cells. PMID: 27820601
  2. SCAI acts as a novel transcriptional cofactor that regulates epithelial-to-mesenchymal transition (EMT) and renal fibrosis. PMID: 23178076
Database Links
Protein Families
SCAI family
Subcellular Location
Membrane; Single-pass membrane protein. Nucleus. Cytoplasm. Note=Nuclear localization is required for inhibition of MRTFA.
Tissue Specificity
Expressed in most tissues tested with higher expression levels in brain, spleen and thymus.

Q&A

What is SCAI protein and what is its role in DNA repair pathways?

SCAI (Suppressor of Cancer cell Invasion) is a highly conserved protein among vertebrates that plays crucial roles in multiple DNA repair processes. Though originally identified as a transcriptional regulator and suppressor of cell migration, research has revealed its significant function in DNA repair mechanisms . SCAI has been established as an integral component of the Fanconi anemia (FA) pathway, which is responsible for repairing DNA interstrand crosslinks (ICLs) .

The protein operates at a critical junction between translesion DNA synthesis (TLS) and homologous recombination (HR) during ICL repair. When SCAI is absent, HR-mediated ICL repair becomes defective, causing DNA breaks to be re-ligated by polymerase θ-dependent microhomology-mediated end-joining (MMEJ) . This alternative pathway generates deletions spanning the ICL site and forms radial chromosomes, compromising genomic stability . SCAI essentially functions as a pathway choice regulator, ensuring that DNA damage is repaired through more accurate mechanisms rather than error-prone alternatives.

How is SCAI recruited to DNA damage sites?

SCAI demonstrates dynamic localization patterns in response to various types of DNA damage. In cells expressing GFP-tagged human SCAI at near-physiological levels, researchers have observed SCAI recruitment to both microlaser-generated and ionizing radiation (IR)-generated double-strand break (DSB) sites . This recruitment pattern indicates SCAI's direct involvement at the sites of DNA damage.

In Xenopus egg extract systems, SCAI shows prominent enrichment at DNA damage-containing chromatin alongside multiple known DNA damage response components . For interstrand crosslink (ICL) repair specifically, SCAI is efficiently recruited to ICL-containing plasmids in a replication-dependent manner . This recruitment occurs early in the repair reaction and remains unaffected by inhibition of p97, which typically blocks CMG unloading and downstream unhooking of the ICL .

Additionally, SCAI is enriched at UV-C-damaged chromatin, unlike 53BP1, suggesting it has distinct roles in responding to different types of DNA damage . These recruitment dynamics highlight SCAI's versatility in DNA repair mechanisms and confirm its direct action at damage sites rather than through indirect signaling pathways.

What are the known protein interactions of SCAI relevant to its function?

SCAI engages in numerous protein interactions that are crucial for its function in DNA repair pathways. Mass spectrometry analysis has revealed several key interaction partners:

  • Polymerase ζ (Polζ) complex: All five subunits of the Polζ complex (REV1, REV3, REV7, POLD2, and POLD3) are strongly enriched in SCAI immunoprecipitates . The interaction with REV3 appears to be direct and is mediated by a conserved region within REV3's PCD domain that shares homology with AHDC1, another SCAI interactor .

  • 53BP1: SCAI interacts with 53BP1, a key factor in double-strand break repair . This interaction appears functionally significant for promoting DSB repair efficiency, though SCAI and 53BP1 have distinct roles in certain contexts.

  • Heterochromatin-associated factors: SCAI interacts with heterochromatin proteins including HP1β (Cbx1) and HP1α (Cbx5) .

  • FA pathway components: SCAI immunoprecipitates contain numerous Fanconi anemia proteins, suggesting extensive interactions with components of this DNA repair pathway .

The interaction between SCAI and the Polζ complex is particularly notable, as SCAI immunodepletion co-depletes REV3 and to a lesser extent REV1 and REV7 . A Xenopus REV3 peptide spanning the interacting sequence efficiently binds purified recombinant SCAI, confirming that the SCAI-REV3 interaction is direct .

What methods are effective for studying SCAI recruitment to DNA damage sites?

Several established methodologies have proven effective for studying SCAI recruitment to various DNA damage sites:

  • Fluorescence microscopy with tagged SCAI: Using cells expressing GFP-tagged human SCAI at near-physiological levels allows researchers to directly visualize SCAI localization at DNA damage sites . This approach can be combined with microlaser- or ionizing radiation-induced DNA damage to study recruitment dynamics in real-time.

  • Chromatin association assays in cell-free systems: In Xenopus egg extracts, researchers can observe SCAI enrichment at DNA damage-containing chromatin alongside other DNA damage response proteins . This system allows for biochemical manipulation and temporal analysis of recruitment patterns.

  • Site-specific DNA lesion assays: Plasmids containing site-specific interstrand crosslinks (ICLs) or DNA-protein crosslinks (DPCs) can be used to study SCAI recruitment during specific repair processes . These assays reveal that SCAI is recruited to ICL sites in a replication-dependent manner early in the repair process.

  • Inhibitor studies: By applying specific inhibitors like those targeting p97, researchers can determine at which stage of repair SCAI is recruited . Such studies have shown that SCAI recruitment to ICLs occurs before CMG unloading and unhooking steps.

These complementary approaches provide a comprehensive toolkit for analyzing SCAI recruitment to different types of DNA damage, offering insights into the timing and context of SCAI function in various repair pathways.

How can researchers generate and validate SCAI-deficient experimental models?

Creating and validating effective SCAI-deficient models is crucial for studying this protein's functions. Several approaches have been successfully implemented:

  • CRISPR/Cas9-mediated knockout: The generation of SCAI knockout cell lines using CRISPR/Cas9 technology provides a clean system to study the consequences of SCAI deficiency . These models can be validated through:

    • Western blotting to confirm absence of SCAI protein

    • DNA sequencing to verify gene disruption

    • Functional assays like DNA damage sensitivity tests to confirm phenotypic changes

  • Immunodepletion in cell-free systems: In Xenopus egg extracts, SCAI can be depleted using specific antibodies . This approach allows for:

    • Biochemical analysis of repair processes in the absence of SCAI

    • Complementation with recombinant SCAI to confirm specificity of observed defects

    • Co-depletion analysis to identify proteins that interact tightly with SCAI

  • Mouse knockout models: SCAI knockout mice have been generated and characterized, showing phenotypes related to radiation sensitivity and reduced testis size in males . Validation includes:

    • Genotyping to confirm gene deletion

    • Protein expression analysis in various tissues

    • Phenotypic characterization including radiation sensitivity and tissue-specific effects

    • Assessment of DNA repair capacity in cells derived from these mice

  • siRNA/shRNA knockdown: While not mentioned specifically in the search results, RNA interference approaches provide an alternative for transient SCAI depletion, which may be useful for initial screening or in systems where complete knockout is challenging.

Each model system offers distinct advantages for studying different aspects of SCAI function, from molecular interactions to physiological roles in complex organisms.

What assays can assess the functional impact of SCAI deficiency on DNA repair?

Several specialized assays can effectively measure how SCAI deficiency impacts DNA repair mechanisms:

  • DNA damage sensitivity assays: Treating SCAI-deficient cells or organisms with DNA-damaging agents reveals functional deficiencies in repair pathways. SCAI knockout mice show approximately 2-fold decreased survival after whole-body ionizing radiation , and SCAI knockout cells display moderate sensitivity to UV-C radiation . Sensitivity to ICL-inducing agents like mitomycin C (MMC) is particularly relevant given SCAI's role in the FA pathway .

  • Metaphase chromosome spread analysis: This technique visualizes chromosomal abnormalities resulting from defective DNA repair. In SCAI-deficient systems, researchers observe radial chromosomes following ICL damage, indicative of improper repair through error-prone pathways .

  • Molecular analysis of repair intermediates: In cell-free systems like Xenopus egg extracts, researchers can monitor the formation and resolution of repair intermediates. SCAI depletion specifically delays Polζ-mediated bypass of peptide adducts during DNA-protein crosslink repair, evidenced by the persistence of specific nascent strand products .

  • ICL repair pathway choice analysis: In the absence of SCAI, HR-mediated ICL repair is defective, with breaks instead re-ligated by polymerase θ-dependent MMEJ . This pathway switch can be detected by analyzing repair products for deletions spanning the ICL site, which are characteristic of MMEJ.

  • Genetic interaction screens: CRISPR screens can identify genes whose loss suppresses or enhances MMC hypersensitivity in SCAI knockout cells, revealing genetic interactions and potential compensatory pathways .

How does SCAI regulate the choice between DNA repair pathways?

SCAI functions as a crucial pathway choice regulator during DNA repair, particularly in the resolution of interstrand crosslinks (ICLs). Its role in pathway choice involves several mechanisms:

  • Promoting HR over MMEJ: SCAI directs repair toward error-free homologous recombination (HR) rather than error-prone microhomology-mediated end joining (MMEJ) . In the absence of SCAI, HR-mediated ICL repair becomes defective, and double-strand break intermediates are instead repaired by polymerase θ-dependent MMEJ, generating deletions and chromosomal abnormalities .

  • Coordinating repair steps: SCAI operates at the critical interface between translesion DNA synthesis (TLS) and HR during ICL repair . By coordinating these sequential steps, SCAI ensures that DNA double-strand break intermediates generated during ICL repair are processed appropriately for HR rather than alternative pathways.

  • Interacting with multiple repair factors: SCAI's interactions with Polζ complex components and Fanconi anemia pathway proteins likely contribute to its role in pathway choice . These interactions may help assemble appropriate repair complexes at damage sites and facilitate the handover between different repair steps.

  • Context-dependent functions: SCAI's influence on pathway choice appears to depend on the type of DNA damage. In addition to its role in ICL repair, SCAI is involved in double-strand break repair and UV damage response, suggesting broader regulatory functions in DNA repair pathway selection .

The molecular mechanisms by which SCAI influences these pathway choices are still being elucidated, but its position at the intersection of multiple repair pathways makes it a key determinant of repair outcomes and genomic stability.

What is the relationship between SCAI and the Fanconi anemia pathway?

SCAI has been established as an integral component of the Fanconi anemia (FA) pathway, which is essential for the repair of DNA interstrand crosslinks (ICLs). The relationship between SCAI and the FA pathway encompasses several aspects:

  • Functional integration: SCAI operates within the FA pathway, specifically at the interface between translesion DNA synthesis (TLS) and homologous recombination (HR) steps . This positioning is critical, as defects in at least 22 FA pathway proteins are causative of Fanconi anemia, a rare inherited disorder characterized by genomic instability .

  • Physical interactions: Mass spectrometry analysis of SCAI immunoprecipitates from Xenopus egg extracts shows enrichment of numerous FA proteins, indicating physical associations with multiple components of the pathway . These interactions suggest SCAI's integration within the broader FA protein network.

  • Recruitment dynamics: SCAI is efficiently recruited to ICL sites in a replication-dependent manner, consistent with the activation of the FA pathway during S-phase when replication forks encounter crosslinks . This recruitment occurs early in the repair process and precedes later steps like CMG unloading and ICL unhooking.

  • Pathway integrity: Interestingly, SCAI depletion does not functionally co-deplete the FA core complex, as evidenced by intact ID2 monoubiquitylation during replication-coupled ICL repair . This suggests that SCAI acts downstream of or parallel to the initial FA pathway activation steps involving FANCD2-FANCI ubiquitination.

  • Error prevention: Like other FA pathway components, SCAI prevents erroneous ICL repair that would otherwise lead to genomic instability . When SCAI is absent, ICL repair proceeds through error-prone MMEJ rather than error-free HR, similar to defects seen in FA patients' cells.

This relationship positions SCAI as an important regulator within the FA pathway, ensuring that ICL repair proceeds through appropriate mechanisms to maintain genomic stability.

How does SCAI interact with the polymerase ζ complex in DNA repair?

SCAI maintains a complex and multifaceted relationship with the polymerase ζ (Polζ) complex during DNA repair processes:

  • Direct physical interaction: Mass spectrometry analysis reveals that all five subunits of the Polζ complex (REV1, REV3, REV7, POLD2, and POLD3) are strongly enriched in SCAI immunoprecipitates from Xenopus egg extracts . Correspondingly, SCAI is enriched in REV1, REV7, and REV3 immunoprecipitates, indicating mutual association .

  • Molecular basis of interaction: The interaction between SCAI and REV3 is direct, mediated by a conserved region within REV3's PCD (Polζ conserved domain) domain . This region shares notable homology with AHDC1, another SCAI interactor . Experiments with Xenopus REV3 peptides spanning this sequence confirm direct binding to purified recombinant SCAI .

  • Co-depletion effects: SCAI immunodepletion from Xenopus egg extracts co-depletes REV3 and to a lesser extent REV1 and REV7, suggesting a tight association between SCAI and the Polζ complex . This observation explains why SCAI depletion causes delays in TLS during repair processes.

  • Functional coordination: SCAI and Polζ complex components accumulate with similar kinetics on plasmids containing various DNA lesions, including DNA-protein crosslinks . During DNA-protein crosslink repair, SCAI depletion specifically delays Polζ-mediated bypass of peptide adducts, indicating a functional role for SCAI in regulating Polζ activity .

  • Independent functions: Despite their strong association, SCAI prevents erroneous ICL repair independently of its role with Polζ . This suggests that SCAI has additional functions beyond TLS regulation, likely involving other repair pathways or factors.

This relationship positions SCAI as both a physical partner and functional regulator of the Polζ complex during translesion DNA synthesis, while maintaining distinct roles in ensuring error-free DNA repair.

What phenotypes are observed in SCAI-deficient mouse models?

SCAI-deficient mouse models display several notable phenotypes that highlight the protein's physiological importance:

  • Increased radiation sensitivity: When exposed to whole-body ionizing radiation, SCAI knockout (SCAI−/−) mice die more quickly than control animals, showing approximately 2-fold decreased survival in both males and females . This heightened sensitivity reflects SCAI's crucial role in DNA repair processes, particularly in responding to radiation-induced damage.

  • Reproductive system abnormalities: Male SCAI−/− mice exhibit markedly reduced testis size compared to controls . This phenotype suggests SCAI plays an important role in testicular development or spermatogenesis, potentially reflecting the importance of error-free DNA repair during the complex cellular divisions of sperm development.

  • Normal immune function: Unlike mice lacking 53BP1 (another DNA repair factor that interacts with SCAI), SCAI−/− mice show no obvious defects in immune system development or function . Specifically:

    • SCAI−/− and control mice display comparable splenic B cell numbers and frequencies

    • B cells from SCAI−/− mice show normal proliferation and class-switching to IgG1 and IgG3 when stimulated ex vivo

    • Blood serum levels of IgG1, IgG3, and IgM are comparable between SCAI−/− and control mice

  • Genomic instability: Though not directly assessed in the mouse model studies, cellular studies suggest SCAI deficiency would lead to increased chromosomal abnormalities and genomic instability due to error-prone DNA repair . This instability likely contributes to the radiation sensitivity phenotype observed in vivo.

These phenotypes highlight SCAI's tissue-specific and context-dependent roles, particularly in maintaining genomic stability under stress conditions and in reproductive system development.

How does SCAI contribute to genomic stability in different cellular contexts?

SCAI maintains genomic stability through multiple mechanisms that vary across cellular contexts:

These diverse roles highlight SCAI's versatility as a guardian of genomic stability across different types of DNA damage and cellular contexts.

What is the potential significance of SCAI in cancer and genetic disorders?

The multifaceted roles of SCAI in DNA repair pathways suggest several potential implications for cancer and genetic disorders:

  • Fanconi anemia connections: SCAI functions as an integral component of the Fanconi anemia (FA) pathway . Defects in at least 22 proteins in this pathway cause Fanconi anemia, a rare inherited disorder characterized by bone marrow failure, developmental abnormalities, and cancer predisposition . Given SCAI's role in this pathway, alterations in SCAI function could potentially contribute to FA-like phenotypes or modify disease severity in FA patients.

  • Cancer suppression: SCAI was originally identified as a Suppressor of Cancer cell Invasion, suggesting a role in preventing metastasis . Its functions in maintaining genomic stability through error-free DNA repair further support a potential tumor suppressor role. When SCAI is absent, error-prone repair generates deletions and chromosomal abnormalities that could contribute to carcinogenesis .

  • Radiation sensitivity: SCAI deficient mice show approximately 2-fold decreased survival after whole-body ionizing radiation compared to controls . This suggests that SCAI status might influence radiation sensitivity in cancer patients undergoing radiotherapy, potentially serving as a biomarker for treatment response.

  • Male fertility: Male SCAI knockout mice have markedly reduced testis size, suggesting defective spermatogenesis and potential subfertility . This indicates SCAI might play a role in certain forms of male infertility in humans, particularly those associated with defective DNA repair during spermatogenesis.

  • UV sensitivity: SCAI knockout cells show moderate sensitivity to UV-C radiation . This suggests potential involvement in skin cancer susceptibility or photosensitivity disorders, though more research is needed to establish clinical relevance.

The connections between SCAI function and these conditions highlight its potential significance as both a biomarker and therapeutic target in various disease contexts, warranting further investigation into its clinical implications.

What are the key considerations for working with recombinant SCAI protein?

When working with recombinant SCAI protein for research applications, several key considerations should be addressed:

These considerations ensure that recombinant SCAI protein maintains its structural integrity and functional properties for experimental applications.

What methods can be used to study SCAI-Polζ interaction in experimental systems?

Several sophisticated methodologies can be employed to study the interaction between SCAI and the polymerase ζ (Polζ) complex:

  • Co-immunoprecipitation (Co-IP) assays: This approach has successfully demonstrated SCAI-Polζ interactions in both Xenopus egg extracts and human cells . The procedure involves:

    • Immunoprecipitating SCAI and detecting Polζ components (REV1, REV3, REV7, etc.) in the precipitates

    • Reciprocal IP experiments pulling down Polζ components and detecting SCAI

    • Label-free mass spectrometry analysis of immunoprecipitates to identify interaction partners comprehensively

  • Direct binding assays with purified proteins: The direct interaction between SCAI and REV3 has been demonstrated using:

    • Purified recombinant SCAI protein

    • Xenopus REV3 peptides spanning the potential interaction region

    • In vitro binding assays showing that REV3 peptides efficiently bind to purified SCAI

  • Domain mapping through mutational analysis: The conserved region within REV3's PCD domain that mediates interaction with SCAI was identified through:

    • Sequence analysis comparing REV3 with AHDC1, another SCAI interactor

    • Mutational studies showing that this region is required for interaction with SCAI in human cells

  • Functional co-recruitment assays: SCAI and Polζ complex components accumulate with similar kinetics on:

    • Plasmids containing site-specific DNA-protein crosslinks

    • ICL-containing DNA during replication-coupled repair

    • These assays demonstrate coordinated recruitment and function in relevant repair contexts

  • Co-depletion analysis: SCAI immunodepletion from Xenopus egg extracts co-depletes REV3 and to a lesser extent REV1 and REV7 . This approach reveals the strength of association between SCAI and different Polζ components in native complexes.

These complementary approaches provide a comprehensive toolkit for studying the molecular details, dynamics, and functional consequences of SCAI-Polζ interactions in different experimental systems.

How can researchers design experiments to investigate SCAI's role in ICL repair pathway choice?

Designing robust experiments to investigate SCAI's role in interstrand crosslink (ICL) repair pathway choice requires multifaceted approaches:

  • Genetic manipulation systems:

    • Generate SCAI knockout cell lines using CRISPR/Cas9 technology

    • Create complementation systems with wild-type or mutant SCAI to identify functional domains

    • Develop inducible SCAI depletion systems for temporal control of expression

  • ICL damage induction methods:

    • Site-specific ICLs in plasmids for mechanistic studies in cell-free systems like Xenopus egg extracts

    • Chemical ICL-inducing agents like mitomycin C (MMC) for cellular sensitivity assays

    • Psoralen plus UVA treatment for generating ICLs in genomic DNA in live cells

  • Repair pathway analysis techniques:

    • Monitor HR efficiency using reporter constructs in SCAI-proficient versus deficient cells

    • Analyze MMEJ activity using specific reporter systems to detect error-prone repair

    • Examine repair junction sequences to identify hallmarks of different repair pathways (extensive homology for HR versus microhomology for MMEJ)

  • Microscopy approaches:

    • Track recruitment kinetics of pathway-specific factors (RAD51 for HR, Polθ for MMEJ) in SCAI-proficient versus deficient cells

    • Employ high-resolution microscopy to visualize co-localization of SCAI with repair factors at damage sites

    • Use live-cell imaging to monitor pathway choice in real-time

  • Biochemical assays:

    • Assay for specific repair intermediates (like D-loops for HR or microhomology-mediated joining products for MMEJ)

    • Perform in vitro reconstitution of repair steps with purified components including SCAI

    • Examine chromatin modifications associated with different repair pathways in the presence or absence of SCAI

  • Genetic interaction screens:

    • Conduct synthetic lethality screens in SCAI-deficient backgrounds to identify compensatory pathways

    • Use CRISPR screens to identify genes that suppress or enhance ICL sensitivity in SCAI knockout cells

    • Apply drugZ algorithm analysis (using a NormZ value < −3 as cutoff) to identify significant genetic interactions

These experimental approaches collectively provide a comprehensive framework for dissecting SCAI's specific role in directing ICL repair toward error-free homologous recombination rather than error-prone microhomology-mediated end joining.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.