Recombinant Mouse Protein SYS1 homolog (Sys1)

Shipped with Ice Packs
In Stock

Description

Key Features

Recombinant SYS1 homolog is engineered for high-purity expression in diverse host systems, including E. coli, yeast, and mammalian cells . The protein retains critical functional domains, enabling studies on its role in protein trafficking.

ParameterValueSource
Molecular Weight~17.5 kDa (calculated based on amino acid sequence)
Host OrganismsE. coli, yeast, or mammalian cells (e.g., HEK293T)
TagsN-terminal tags (e.g., His, Strep, C-Myc/DDK)
Purity≥85% (determined by SDS-PAGE and Coomassie blue staining)
Storage ConditionsLyophilized powder stored at -20°C or -80°C

Production Highlights

  • Expression Systems: The protein is often expressed in E. coli for cost-effective production, though mammalian systems (e.g., HEK293T) are used for post-translational modifications .

  • Purification: Affinity chromatography (e.g., Strep-tag or His-tag) ensures high purity, with SDS-PAGE confirming monomeric integrity .

  • Tag Variants: N-terminal His, Strep, or C-Myc/DDK tags facilitate downstream applications like Western blotting or protein interaction assays .

Primary Biological Functions

SYS1 homolog is implicated in protein trafficking and organelle dynamics, particularly in the Golgi apparatus. Key findings include:

FunctionDescriptionSupporting Evidence
Protein TraffickingFacilitates the transport of cargo proteins between organelles (e.g., ER to Golgi).Inferred from homolog studies
Receptor ActivityMay bind ARFRP1 (ADP-ribosylation factor-related protein 1), regulating vesicle dynamics.By similarity to yeast Sys1
Golgi LocalizationAnchored in Golgi membranes, enabling interaction with trafficking machinery.Structural homology to human Sys1

Mechanistic Insights

  • ARFRP1 Interaction: While direct evidence in mice is limited, homologs in other species suggest SYS1 binds ARFRP1 to modulate membrane remodeling during vesicle formation .

  • Golgi-ER Shuttle: The protein’s integral membrane structure positions it as a critical component in retrograde trafficking pathways .

Common Applications

Recombinant SYS1 homolog is utilized in:

  1. Bioassays: Testing receptor-ligand interactions (e.g., ARFRP1 binding).

  2. SDS-PAGE: Verifying protein integrity and purity .

  3. Western Blotting: Detecting expression or post-translational modifications using tag-specific antibodies .

Example Workflow

  1. Expression: Clone SYS1 cDNA into vectors (e.g., pET-28a for E. coli) .

  2. Purification: Use nickel affinity chromatography (His-tag) or Strep-Tactin columns .

  3. Validation: Analyze via SDS-PAGE (silver staining) to confirm monomeric bands (~17.5 kDa) .

Functional Data

ExperimentObservationMethod
SDS-PAGESingle band at ~17.5 kDa under reducing conditionsSilver staining
Western BlotC-Myc/DDK-tagged SYS1 detected using anti-tag antibodiesCoomassie blue
Cell-Free Expression>70% purity achievable via AliCE® system with Strep-tag purificationSEC-MALS

Limitations

  • Species-Specific Data: Most functional studies derive from yeast or human homologs, necessitating validation in murine models.

  • Modifications: Limited data on post-translational modifications (e.g., phosphorylation) in mice.

Research Priorities

  1. Structural Studies: Cryo-EM or X-ray crystallography to map ARFRP1 binding sites.

  2. In Vivo Models: Assessing SYS1 knockouts in mice to evaluate developmental or metabolic phenotypes.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please include it in your order notes. We will accommodate your request whenever possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Sys1; Protein SYS1 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Sys1
Target Protein Sequence
MAGQFRSYVWDPLLILSQIVLMQTVYYGSLGLWLALVDALVRSSPSLDQMFDAEILGFST PPGRLSMMSFVLNALTCALGLLYFIRRGKQCLDFTVTVHFFHLLGCWLYSSRFPSALTWW LVQAVCIALMAVIGEYLCMRTELKEIPLSSAPKSNV
Uniprot No.

Target Background

Function
Plays a crucial role in protein trafficking. It may act as a receptor for ARFRP1.
Database Links

KEGG: mmu:66460

UniGene: Mm.44218

Protein Families
SYS1 family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is Mouse Protein SYS1 homolog and what is its functional significance?

Mouse Protein SYS1 homolog is a Golgi-localized integral membrane protein that plays a critical role in protein trafficking pathways. It functions primarily as a receptor for ADP-ribosylation factor-related protein 1 (ARFRP1), forming a complex that facilitates proper protein targeting to the Golgi apparatus. The mouse SYS1 protein shares remarkably high sequence identity (approximately 97%) with its human ortholog, suggesting strong evolutionary conservation and functional importance across mammalian species . As an integral component of the Golgi trafficking machinery, SYS1 contributes to maintaining cellular homeostasis through its involvement in vesicular transport and protein sorting mechanisms. Understanding its function has implications for both basic cell biology research and investigations into pathological conditions where protein trafficking is disrupted.

What is the structural organization of Mouse SYS1 protein?

Mouse SYS1 protein is structurally characterized as a Golgi-localized integral membrane protein. While complete structural data is still evolving, analysis of its human homolog (with 97% sequence identity) reveals key functional regions, including transmembrane domains that anchor it within the Golgi membrane and protein interaction domains that facilitate binding with ARFRP1 . The high degree of conservation between mouse and human SYS1 proteins suggests similar structural features between these orthologs. The protein contains specific amino acid sequences that are critical for its localization and function, particularly in the regions that interact with other trafficking components. Experimental approaches utilizing recombinant fragments of specific amino acid sequences, such as those between positions 36-67 in the human ortholog, have been valuable for functional and structural studies .

What molecular mechanisms govern the interaction between Mouse SYS1 and ARFRP1?

The interaction between Mouse SYS1 and ARFRP1 represents a sophisticated molecular mechanism central to Golgi trafficking. SYS1 serves as a specific receptor for ARFRP1, with this interaction being critical for properly targeting ARFRP1 to the Golgi apparatus . The binding mechanism likely involves specific amino acid sequences within SYS1 that recognize activated (GTP-bound) ARFRP1. This interaction is thought to be regulated by conformational changes triggered by guanine nucleotide exchange factors (GEFs) and GTPase-activating proteins (GAPs) that control the GTP/GDP-bound state of ARFRP1.

The molecular architecture of this interaction has been elucidated through research on homologous systems, revealing that SYS1 contains specialized domains that recognize specific structural features of ARFRP1. Research techniques to study this interaction include co-immunoprecipitation, fluorescence resonance energy transfer (FRET), and proximity ligation assays. The SYS1-ARFRP1 complex subsequently recruits additional trafficking components to facilitate vesicle formation, cargo selection, and membrane fusion events essential for maintaining Golgi structure and function.

How does the dysfunction of Mouse SYS1 impact Golgi morphology and cellular trafficking?

Dysfunction of Mouse SYS1 protein significantly disrupts Golgi morphology and cellular trafficking pathways through several mechanisms. When SYS1 function is compromised, the proper localization of ARFRP1 to the Golgi apparatus is impaired, leading to cascading effects on downstream trafficking machinery . This typically results in fragmentation of the Golgi complex, with dispersed ministacks observed throughout the cytoplasm rather than the normal perinuclear ribbon structure.

The trafficking defects manifest as:

  • Impaired anterograde transport from the ER to Golgi

  • Disrupted intra-Golgi trafficking between cisternae

  • Compromised sorting of cargo proteins to appropriate destinations

  • Altered glycosylation patterns of secreted and membrane proteins

These structural and functional alterations can be visualized using high-resolution microscopy techniques, including super-resolution microscopy and electron microscopy. Quantitative assessments of trafficking defects typically employ pulse-chase experiments with radiolabeled or fluorescently tagged cargo proteins, revealing delays in transport kinetics and missorting of cargo. Single-subject experimental design (SSED) approaches can be particularly valuable for tracking the temporal progression of Golgi disruption following SYS1 manipulation .

What are optimal methods for producing and purifying recombinant Mouse SYS1 protein?

Production and purification of recombinant Mouse SYS1 protein requires specialized approaches due to its nature as a membrane protein. Based on established protocols for similar proteins, the following methodological framework is recommended:

Expression Systems Options:

  • Bacterial systems (E. coli): Suitable for soluble domains but challenging for full-length protein due to membrane integration requirements

  • Insect cell systems: Better for full-length expression with proper folding

  • Mammalian cell systems: Optimal for obtaining functionally active protein with proper post-translational modifications

Purification Strategy:

  • Construct design with affinity tags (His-tag or GST-tag) positioned to avoid interference with functional domains

  • Detergent screening to identify optimal solubilization conditions (typically Triton X-100, DDM, or CHAPS)

  • Two-step purification combining affinity chromatography with size exclusion chromatography

  • Quality control assessment through Western blotting, mass spectrometry, and functional assays

For applications requiring only specific domains rather than the full-length protein, designing truncated constructs containing key functional regions can be advantageous. For instance, expression of fragments similar to the human SYS1 amino acids 36-67 region has been successfully employed for functional studies and as control fragments in blocking experiments . Proper folding and stability assessment using circular dichroism spectroscopy should be conducted to ensure the recombinant protein maintains its native structure throughout the purification process.

How can researchers validate the functionality of recombinant Mouse SYS1 protein?

Validating the functionality of recombinant Mouse SYS1 protein is essential before proceeding with experimental applications. A comprehensive validation strategy should include:

Structural Integrity Assessment:

  • Circular dichroism (CD) spectroscopy to confirm secondary structure elements

  • Limited proteolysis to evaluate proper folding

  • Size exclusion chromatography with multi-angle light scattering (SEC-MALS) to confirm oligomeric state

Functional Validation:

  • ARFRP1 binding assays: Co-immunoprecipitation or pulldown assays to confirm interaction with ARFRP1, which is the primary binding partner

  • Subcellular localization: Transfection into mammalian cells followed by immunofluorescence microscopy to verify Golgi localization

  • Vesicle budding assays: In vitro reconstitution assays to assess participation in membrane trafficking events

  • Blocking experiments: Pre-incubation with antibodies to demonstrate specificity, similar to approaches used with human SYS1 fragments

Comparative Analysis:
Compare the properties of recombinant Mouse SYS1 with endogenous protein using:

  • Migration patterns on SDS-PAGE

  • Recognition by specific antibodies

  • Mass spectrometry analysis of post-translational modifications

  • Functional complementation in SYS1-depleted cells

Researchers should implement single-subject experimental designs (SSEDs) with appropriate controls and replications to establish reliable validation protocols . This approach ensures that functional assessments are reproducible and that the recombinant protein accurately represents the properties of native Mouse SYS1.

What controls should be included in experiments using recombinant Mouse SYS1 protein?

Rigorous experimental design for studies utilizing recombinant Mouse SYS1 protein requires comprehensive controls to ensure valid and reproducible results:

Negative Controls:

  • Heat-denatured SYS1 protein: To distinguish between specific activity and non-specific effects

  • Irrelevant protein of similar size/properties: To control for general protein effects

  • Buffer-only conditions: To establish baseline measurements

  • SYS1 with mutated binding domains: To confirm specificity of molecular interactions

Positive Controls:

  • Endogenous SYS1 preparations: To benchmark recombinant protein activity

  • Well-characterized fragments: Such as those analogous to the human SYS1 (aa 36-67) control fragment

  • Proteins with known SYS1 interaction: ARFRP1 preparations or other validated binding partners

Dosage Controls:

  • Concentration series: To establish dose-response relationships

  • Time-course experiments: To determine temporal aspects of SYS1 activity

Validation Controls:

  • Blocking experiments: Pre-incubation with specific antibodies at defined ratios (e.g., 100x molar excess for 30 minutes at room temperature, as established for human SYS1)

  • Orthogonal assays: Multiple methodologies to confirm the same finding

For experiments investigating protein-protein interactions, controls should include GST-only pulldowns and competition assays with untagged proteins. In cellular experiments, both overexpression and knockdown/knockout approaches should be implemented to establish cause-effect relationships. The principles of single-subject experimental design (SSED) should be followed, with particular attention to replication within experiments to establish internal validity .

How can researchers resolve inconsistent results in SYS1 localization studies?

Inconsistent results in SYS1 localization studies often stem from methodological variations or biological complexities. Researchers can systematically address these discrepancies through:

Methodological Standardization:

  • Fixation protocol optimization: Compare different fixatives (paraformaldehyde, methanol, glutaraldehyde) as membrane proteins can show artifacts with improper fixation

  • Antibody validation: Test multiple antibodies against different epitopes of SYS1, including those that target conserved regions between mouse and human (97% sequence identity)

  • Co-localization controls: Always include established Golgi markers (GM130, TGN46) for reference

Technical Considerations:

  • Cell cycle synchronization: SYS1 localization may vary throughout the cell cycle, particularly during Golgi fragmentation in mitosis

  • Expression level normalization: Overexpression can lead to mislocalization; use inducible systems to control expression levels

  • Imaging parameters standardization: Consistent microscope settings, threshold determination, and quantification methods

Analytical Framework:

  • Implement single-subject experimental design (SSED) principles with multiple replications to establish reliable patterns

  • Utilize quantitative co-localization analysis (Pearson's correlation, Manders' coefficients)

  • Apply statistical tests appropriate for imaging data (typically non-parametric tests due to distribution characteristics)

Biological Variables Table:

VariablePotential Impact on SYS1 LocalizationControl Strategy
Cell typeDifferent Golgi morphology and trafficking ratesUse consistent cell lines; validate across multiple types
Cell densityAffects secretory pathway organizationStandardize seeding density and confluence
Stress conditionsER stress can alter Golgi organizationMonitor stress markers; control experimental conditions
Species differencesDespite 97% homology, subtle differences may existClearly distinguish between mouse and human studies

When reporting results, researchers should explicitly document all methodological details and acknowledge limitations. Latency effects in response to experimental manipulations should be considered when interpreting temporal dynamics of SYS1 localization, as discussed in SSED literature .

What approaches can address challenges in detecting low-abundance SYS1 interactions?

Detecting low-abundance or transient interactions involving Mouse SYS1 protein presents significant technical challenges. Researchers can employ several strategic approaches to overcome these limitations:

Enhanced Detection Methods:

  • Proximity ligation assay (PLA): Enables visualization of protein interactions with single-molecule sensitivity

  • Crosslinking mass spectrometry (XL-MS): Captures transient interactions through chemical crosslinking

  • APEX2 proximity labeling: Tags proteins in close proximity to SYS1 for subsequent identification

Enrichment Strategies:

  • Tandem affinity purification: Reduces background through sequential purification steps

  • Subcellular fractionation: Concentrates Golgi components before interaction analysis

  • Chemical stabilization: Using reversible crosslinkers to stabilize transient complexes

Optimization Parameters:

  • Detergent selection: Critical for membrane protein solubilization without disrupting interactions

  • Buffer conditions: Ionic strength, pH, and divalent cation concentrations significantly impact interaction stability

  • Temperature and time variables: Some interactions may be more stable at specific temperatures

Analytical Approaches:

  • Apply single-subject experimental design (SSED) principles with proper controls and replications

  • Implement statistical methods suitable for rare event detection

  • Use computational prediction tools to guide experimental design for likely interaction partners

Researchers should consider using recombinant SYS1 fragments as competition controls, similar to how human SYS1 (aa 36-67) fragments have been utilized in blocking experiments . For quantitative analysis of low-abundance interactions, specialized software with high-sensitivity algorithms should be employed, with particular attention to distinguishing true signals from background noise.

How do researchers distinguish between direct and indirect effects in SYS1 functional studies?

Distinguishing between direct and indirect effects in SYS1 functional studies requires a multi-faceted experimental approach that systematically isolates causal relationships. The following methodological framework helps researchers establish direct contributions of SYS1 to observed phenotypes:

Temporal Analysis:

  • Acute vs. chronic manipulation: Utilize inducible expression/knockdown systems to observe immediate vs. delayed effects

  • Time-course experiments: Track the sequence of cellular changes following SYS1 manipulation

  • Pulse-chase approaches: Monitor the progression of specific cargo through the secretory pathway

Spatial Resolution:

  • Compartment-specific markers: Track effects on distinct organelles (ER, ERGIC, Golgi sub-compartments)

  • Super-resolution microscopy: Precisely localize SYS1 relative to affected structures

  • Correlative light-electron microscopy: Connect functional observations with ultrastructural changes

Molecular Specificity:

  • Structure-function analysis: Generate SYS1 mutants with selective disruption of specific domains

  • Rescue experiments: Reintroduce wild-type or mutant SYS1 into knockout systems

  • Domain swapping: Replace SYS1 domains with those from related proteins to identify critical regions

Systematic Controls:

  • Parallel pathway analysis: Examine effects on pathways not expected to involve SYS1

  • Secondary target validation: Confirm whether observed effects persist when downstream factors are independently manipulated

  • Biochemical reconstitution: Test whether purified SYS1 is sufficient to reconstitute function in cell-free systems

When analyzing results, researchers should implement the principles of single-subject experimental designs (SSEDs), particularly focusing on replication of effects and careful examination of latency patterns that might suggest indirect mechanisms . The experimental effect must be repeatedly and reliably demonstrated to rule out contribution from extraneous variables. Using control fragments similar to the human SYS1 (aa 36-67) can help in blocking experiments to establish specificity of observed effects .

What emerging technologies show promise for advancing Mouse SYS1 research?

Several cutting-edge technologies are poised to transform our understanding of Mouse SYS1 biology and function:

Advanced Imaging Technologies:

  • Lattice light-sheet microscopy: Enables long-term, high-resolution imaging of SYS1 dynamics in living cells with minimal phototoxicity

  • Cryo-electron tomography: Provides detailed 3D visualization of SYS1 in its native cellular environment

  • Super-resolution microscopy: Techniques like STORM and PALM can resolve SYS1 distribution at nanometer resolution

Genetic Engineering Approaches:

  • CRISPR-Cas9 gene editing: Creation of precise mouse models with tagged endogenous SYS1 or specific mutations

  • Optogenetic control: Light-activated regulation of SYS1 function to study temporal aspects of protein trafficking

  • Degron systems: Rapidly inducible protein degradation for acute functional studies

Protein Analysis Technologies:

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Maps conformational changes in SYS1 during protein interactions

  • Integrative structural biology: Combines multiple techniques (X-ray crystallography, NMR, cryo-EM) to resolve SYS1 structure

  • Protein microarrays: High-throughput screening of SYS1 interactions across the proteome

Computational Approaches:

  • Molecular dynamics simulations: Models SYS1 membrane integration and protein-protein interactions

  • Machine learning algorithms: Predicts functional consequences of SYS1 variants

  • Systems biology modeling: Integrates SYS1 function into comprehensive Golgi trafficking networks

These technologies should be implemented within the framework of rigorous experimental design principles, as outlined in single-subject experimental design (SSED) literature , to ensure reproducible and valid findings. The high sequence homology between mouse and human SYS1 (97%) suggests that technologies developed for one species may be readily adaptable to the other, facilitating translational research applications.

How might the study of Mouse SYS1 contribute to understanding human disease mechanisms?

Research on Mouse SYS1 has significant translational potential for understanding human disease mechanisms, particularly given the high sequence homology (97%) between mouse and human orthologs . Several promising research directions include:

Neurological Disorders:

  • Protein aggregation diseases: SYS1 dysfunction may contribute to impaired clearance of aggregation-prone proteins in neurodegenerative disorders

  • Axonal transport defects: Altered trafficking machinery can impact neuronal function and survival

  • Synaptic dysfunction: Proper Golgi trafficking is essential for synaptic vesicle composition and receptor localization

Metabolic Diseases:

  • Lipid storage disorders: SYS1-mediated trafficking is involved in lipid transport and metabolism

  • Insulin secretion defects: Golgi trafficking is critical for insulin processing and secretion

  • Lysosomal storage diseases: Missorting of lysosomal enzymes due to trafficking defects

Inflammatory Conditions:

  • Cytokine processing abnormalities: Similar to effects observed with S1SP in lung inflammation models

  • Immune cell dysfunction: Altered receptor trafficking affecting immune cell signaling

  • Epithelial barrier disruption: Potential parallels to tight junction compromise seen in lung injury models

Research Translation Framework:

Disease CategoryMouse SYS1 Research ApproachHuman Disease Application
Developmental disordersConditional knockout modelsCongenital disorders of glycosylation
Cancer biologyTrafficking of growth factor receptorsTherapeutic targeting of trafficking pathways
Infectious diseasesPathogen subversion of traffickingNovel anti-infective strategies
Lung disordersBarrier function studiesInsights into acute lung injury mechanisms

The application of single-subject experimental design (SSED) methodologies is particularly valuable for establishing causal relationships between SYS1 dysfunction and disease phenotypes . The translational pathway from mouse models to human applications should include verification in human cell models and careful consideration of species-specific differences, despite the high sequence conservation.

How should researchers plan experiments using Single-Subject Experimental Design for SYS1 studies?

Implementing Single-Subject Experimental Design (SSED) for Mouse SYS1 studies requires careful planning to ensure scientific rigor and validity. Based on established SSED principles, researchers should:

Experimental Design Selection:

  • Choose appropriate SSED variant:

    • Multiple-baseline designs for studying SYS1 function across different cell types

    • Withdrawal designs (A-B-A) for reversible SYS1 manipulations

    • Alternating treatments for comparing different SYS1 variants

    • Changing-criterion designs for dose-dependent SYS1 effects

  • Design requirements:

    • Establish stable baseline measurements before intervention

    • Implement systematic phase changes based on objective criteria

    • Include sufficient data points within each phase (minimum 3-5 measurements)

    • Plan for demonstration of experimental control through replication

Implementation Strategy:

  • Baseline establishment: Collect reliable pre-intervention data on dependent variables

  • Intervention planning: Precisely define the SYS1 manipulation (e.g., knockdown, overexpression, mutation)

  • Measurement protocol: Develop consistent, repeatable measurement procedures

  • Data collection frequency: Determine optimal timing for repeated measurements

Analysis Framework:

  • Visual analysis: Plot data to identify level, trend, variability, immediacy of effects, and overlap

  • Replication focus: Design must include at least three demonstrations of effect to establish experimental control

  • Effect size calculation: Consider appropriate metrics for SSED (e.g., percentage of non-overlapping data)

Quality Assurance:

  • Check design against WWCH panel criteria (Table 1 in reference material)

  • Plan for potential latency issues in SYS1 manipulation effects

  • Document procedural fidelity throughout implementation

By following these guidelines, researchers can develop robust SSED studies that provide strong evidence for causal relationships between SYS1 manipulations and observed outcomes. This approach is particularly valuable for studying membrane proteins like SYS1, where individual cell responses may vary and population averages could mask important cellular heterogeneity.

What considerations are important when designing blocking experiments with SYS1 antibodies?

Designing effective blocking experiments with SYS1 antibodies requires careful attention to multiple experimental parameters. Based on established protocols, including those for human SYS1 fragments , researchers should consider:

Antibody Selection and Validation:

  • Epitope specificity: Choose antibodies targeting functional domains versus structural regions

  • Cross-reactivity profile: Test against related proteins, especially important given the 97% sequence identity between mouse and human SYS1

  • Antibody format: Consider whole IgG versus Fab fragments (smaller size may improve access to certain epitopes)

  • Validation methods: Verify antibody specificity through Western blotting, immunoprecipitation, and immunofluorescence

Blocking Protocol Optimization:

  • Antibody-to-target ratio: Follow established guidelines, such as using 100x molar excess of protein fragment control based on concentration and molecular weight

  • Pre-incubation conditions: Standardize temperature, duration (e.g., 30 minutes at room temperature) , and buffer composition

  • Control inclusions: Include isotype controls and non-targeting antibodies

  • Sequential blocking: Test additive effects of multiple antibodies targeting different SYS1 epitopes

Experimental Variables to Control:

  • Order effects: Randomize the sequence of conditions to prevent systematic bias

  • Concentration dependence: Establish full dose-response curves for blocking antibodies

  • Time course evaluation: Determine both immediate and delayed effects of antibody blocking

  • Buffer composition: Optimize salt concentration, pH, and detergent levels

Data Analysis Considerations:

  • Quantification methods: Define clear metrics for measuring blocking efficacy

  • Statistical approach: Employ appropriate tests for comparing blocked versus unblocked conditions

  • Single-subject analysis: Apply SSED principles to evaluate intervention effects with proper replication

Researchers should document all methodological details comprehensively to ensure reproducibility and compare results with established blocking protocols for similar membrane proteins. The effectiveness of blocking can be verified through functional assays specific to SYS1, such as ARFRP1 binding or trafficking assays.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.