Recombinant Mouse Protein tweety homolog 1 (Ttyh1)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Biological Systems

Ttyh1 performs diverse functions across neural and embryonic contexts:

Ion Transport and Calcium Signaling

  • Chloride Channel Activity: Acts as a Ca²⁺-independent, volume-sensitive chloride channel, modulating osmotic stress responses .

  • Calcium Regulation: Maintains ER calcium homeostasis, influencing NSC quiescence via NFATc3 signaling .

Neural Stem Cell Regulation

ProcessTtyh1’s RoleExperimental Evidence
Quiescence MaintenanceSuppresses NSC activation by inhibiting Ca²⁺/NFATc3 signaling.Ttyh1 KO mice show increased BrdU⁺ cells .
Stemness PreservationMaintains self-renewal capacity through Notch signaling modulation.Ttyh1 overexpression enhances neurosphere formation .
NeurogenesisBalances proliferation and differentiation; KO mice exhibit accelerated neurogenesis in adults but exhaustion in aged mice.

Embryonic Development

  • Cell Proliferation: Critical for embryonic growth, particularly during mitosis (evidenced by ER localization during metaphase/anaphase) .

  • Notch Signaling: Regulates Notch intra-cellular domain (NICD) production, linking Ttyh1 to stem cell maintenance .

Expression Patterns and Tissue-Specificity

Ttyh1 exhibits restricted expression:

TissueExpression LevelCell TypeDevelopmental StageSource
BrainHighQuiescent NSCs, niche astrocytesEmbryonic to adult
Spinal CordModerateNeural progenitors, glial cellsEmbryonic to adult
TestisLowGerm cellsAdult
Gliomas/CancersUpregulatedTumor cells (e.g., astrocytomas)Pathological conditions

Recombinant Ttyh1 in Research Applications

Recombinant Ttyh1 fragments are engineered for:

Antibody Production

  • Extracellular Domains: Used to generate monoclonal antibodies (mAbs) for Western blotting and immunofluorescence .

  • C-Terminal Fragments: Served as controls for antibody specificity (e.g., PA5-54845, PA5-62229) .

Functional Studies

ApplicationMethodOutcomeSource
EV ProductionOverexpression in mammalian cellsInduces extracellular vesicles (EVs) with tubulated membranes.
Cholesterol BindingNative bilayer reconstitutionProm1 binds cholesterol more stably than Ttyh1, influencing EV morphology.
RNA-Seq AnalysisTtyh1 KO vs. WT miceDownregulation of Ca²⁺/NFATc3 targets in quiescent NSCs.

Pathological and Therapeutic Implications

  • Cancer: Overexpression in gliomas and astrocytomas suggests a role in tumor progression .

  • Aging: Ttyh1 deficiency accelerates NSC pool exhaustion, linking it to age-related neurodegeneration .

  • Drug Target: Ttyh1’s regulation of Ca²⁺/NFAT signaling positions it as a candidate for modulating NSC activation in injury repair .

Comparative Analysis: Ttyh1 vs. Prom1

FeatureTtyh1Prom1Source
Membrane BendingInduces highly tubulated EVsLess tubulated EVs, more stable cholesterol binding
Protein Density~5× higher in EV membranesLower density, less crowding effect
Tissue ExpressionBrain, spinal cord, testisBroad (e.g., photoreceptors, epithelia)
Disease AssociationGliomas, cancersRetinal dystrophies (CRRD)

Future Directions

  • Mechanistic Studies: Elucidating Ttyh1’s interaction with Notch and γ-secretase complexes .

  • Therapeutic Strategies: Targeting Ttyh1 to activate quiescent NSCs for regenerative medicine .

  • Structural Biology: Cryo-EM studies to resolve Ttyh1’s gating mechanism and pore architecture .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
Ttyh1; Protein tweety homolog 1; mTTY1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-450
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Ttyh1
Target Protein Sequence
MGAPPGYRPSAWVHLLHQLPRADFQLRPVPSGFAPRDQEYQQALLLVAALAGLGLGLSLI FIAVYLIRFCCCRPPEPHGAKSPPPGGGCVTWSCIAALLVGCAGIGIGFYGNSETSDGVS QLSSALLHANHTLSTIDDVVLETVERLGEAVKTELTTLEEVLSVRMELVAATRGARRQAE AAAQYLQGLAFWQGVSLSPVQVAEDVTFVEEYRWLAYVLLLLLVLLVCLFTLLGLAKQSK WLVVVMTAMSLLVLVLSWGSMGLEAATAVGLSDFCSNPDTYVLNLTQEETGLSSDILSYY FLCNQAVSNPFQQRLTLSQRALASIHSQLQGLEREAIPQFSAAQKPLLSLEETLNVTERS FHQLVALLHCRSLHKDYGSALRGLCEDALEGLLFLMLFSLLSAGALATTLCSLPRAWALF PPSDDYDDTDDDDPFNPQESKRFVQWQSSI
Uniprot No.

Target Background

Function
Probable chloride channel. May be involved in cell adhesion.
Gene References Into Functions
  1. This report identifies tweety-homolog 1 (Ttyh1), a membrane protein associated with neuronal development, as a significant driver of tumor microtube (TM)-mediated brain colonization by glioma cells. PMID: 28607172
  2. Ttyh1 plays a critical role during mitosis in early embryogenesis, potentially by regulating Ca(2+) homeostasis in the endoplasmic reticulum. PMID: 20568244
Database Links
Protein Families
Tweety family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Restricted mainly to neural tissues. Strongly expressed in brain and eye.

Q&A

What is Ttyh1 and what are its structural characteristics?

Ttyh1 is a transmembrane protein belonging to the Tweety Homology family, characterized by a five-transmembrane topology similar to Prominin proteins (Prom), but with shorter extracellular domains (approximately 120 amino acids in Ttyh versus 280 in Prom) . Ttyh1 was originally identified as a maxi-chloride channel, though its functional significance extends beyond ion channel activity. Unlike other transmembrane proteins, Ttyh1 does not show conserved cholesterol recognition amino acid consensus (CRAC) or CARC sites across metazoan species, which distinguishes it from the Prominin family .

Where is Ttyh1 primarily expressed in mammalian tissues?

Ttyh1 is predominantly expressed in neural tissues, consistent with its paralogous family members Ttyh2 and Ttyh3 . Expression is particularly notable in neural stem cell regions including the ventricular zone (VZ) and subventricular zone (SVZ) of the developing brain . In adult brains, Ttyh1 maintains expression in neurogenic niches including the SVZ and subgranular zone (SGZ) of the hippocampus, where it helps regulate adult neurogenesis .

What signaling pathways does Ttyh1 interact with?

Ttyh1 prominently interacts with the Notch signaling pathway by enhancing γ-secretase activity, thereby increasing Notch intracellular domain (NICD) production and activation of downstream Notch targets . Quantitative real-time PCR analysis demonstrates that Ttyh1 expression upregulates mRNA levels of Notch target genes including Hes1, Hes5, and Hey1 in primary neural progenitor cells . This interaction with Notch signaling appears to be unique to Ttyh1 among all Ttyh family members, as neither Ttyh2 nor Ttyh3 demonstrate comparable effects on Notch target gene expression .

How does Ttyh1 differ from other Ttyh family members?

Despite shared structural similarities among Ttyh family members (Ttyh1, Ttyh2, and Ttyh3), Ttyh1 exhibits unique functional properties. Specifically, only Ttyh1 enhances Notch signaling and neural stem cell maintenance . Experimental evidence shows that overexpression of Ttyh2 or Ttyh3 does not reproduce the effects observed with Ttyh1 overexpression, both in vitro (Notch target gene expression) and in vivo (cell localization in the VZ/SVZ) . This functional divergence suggests specialized roles for Ttyh1 in neural development despite structural conservation within the Ttyh family.

What molecular mechanisms underlie Ttyh1's enhancement of neural stem cell properties?

Ttyh1 enhances neural stem cell (NSC) properties through a multi-step molecular pathway involving interaction with retention in endoplasmic reticulum 1 (Rer1) protein. The mechanistic sequence begins with Ttyh1 binding to Rer1 in the endoplasmic reticulum, which destabilizes Rer1 protein levels . Since Rer1 normally inhibits γ-secretase activity, this destabilization leads to enhanced γ-secretase function, resulting in increased Notch intracellular domain (NICD) production and subsequent activation of Notch target genes .

This mechanism has been confirmed through multiple experimental approaches:

  • Overexpression of Rer1 completely abolishes Ttyh1's effect on NSC maintenance, confirming Rer1 as the key regulatory target

  • Co-introduction of dominant negative presenilin-1 (dnPS1, a γ-secretase component) with Ttyh1 restores the position of Ttyh1-expressing cells from VZ/SVZ to intermediate zone to control levels in vivo

  • Dominant negative MAML1 (dnMAML1) expression blocks Ttyh1's ability to enhance Notch target gene expression

Importantly, this enhancement occurs independently of Ttyh1's chloride channel activity, as the R371Q mutation (which alters ion selectivity) does not affect Ttyh1's ability to enhance Notch signaling .

How does Ttyh1 influence membrane dynamics and extracellular vesicle formation?

Ttyh1 demonstrates significant membrane-bending properties that drive the formation of extracellular vesicles (EVs). When expressed in mammalian cells, Ttyh1 induces EVs that are comparable in size to those produced by Prominin 1 (approximately 180 ± 10 nm for Ttyh1 versus 164 ± 14 nm for Prom1), but with distinctive membrane characteristics .

Ttyh1-induced EVs show several notable features compared to Prom1-induced EVs:

The enhanced membrane tubulation seen in Ttyh1 EVs may result from two factors: (1) higher protein concentration in the membrane creating molecular crowding effects, and (2) less stable interaction with cholesterol compared to Prom1 . This provides insight into how structurally related proteins can induce similar cellular processes (EV formation) but with distinctive biophysical properties.

What phenotypic changes occur in Ttyh1 knockout models?

Ttyh1 knockout mice display enhanced neurogenesis in both embryonic and adult stages without obvious defects in gross brain morphology . Key phenotypic changes observed include:

  • Increased numbers of BrdU+ cells in both SVZ and SGZ regions, indicating enhanced neural stem cell proliferation

  • Higher quantity of DCX+ neuroblasts in both neurogenic niches, demonstrating enhanced differentiation

  • Decreased numbers of GFAP+Sox2+ type-B neural stem cells in the SVZ

  • Increased EGFR+ cell population, suggesting more neural stem cells differentiating into transit-amplifying progenitors

These findings collectively indicate that Ttyh1 normally functions to maintain neural stem cell quiescence, and its ablation leads to increased activation of the neural stem cell pool. The lack of obvious morphological defects despite these cellular changes suggests compensatory mechanisms or that Ttyh1's role becomes most crucial under specific physiological conditions.

What techniques are most effective for studying Ttyh1 function in neural stem cells?

Multiple complementary approaches are recommended for comprehensive analysis of Ttyh1 function in neural stem cells:

  • In vitro neurosphere assays: Primary neural progenitor cells can be cultured as neurospheres to assess self-renewal capacity upon Ttyh1 manipulation. Quantification of secondary and tertiary neurosphere formation provides insights into stemness properties .

  • In utero electroporation: This technique allows genetic manipulation of embryonic neural stem cells in their native environment. For Ttyh1 studies, plasmids encoding Ttyh1, shRNA against Ttyh1, or relevant controls are injected into lateral ventricles of E13.5 mouse embryos followed by electrical pulses to introduce the constructs into ventricular zone cells .

  • Immunofluorescence analysis: Key markers for assessing Ttyh1 effects include:

    • Sox2 (neural stem cells)

    • GFAP (type B stem cells when co-labeled with Sox2)

    • EGFR (transit-amplifying progenitors)

    • DCX (neuroblasts)

    • BrdU incorporation (proliferating cells)

  • Quantitative real-time PCR: Essential for measuring expression of Notch target genes (Hes1, Hes5, Hey1) to assess pathway activation .

  • CRISPR/Cas9-mediated knockout: Generation of Ttyh1 knockout models provides valuable insights into its function in vivo, with exon 4 being a suitable target region .

How can researchers effectively isolate and characterize Ttyh1-induced extracellular vesicles?

The following methodology has proven effective for isolation and characterization of Ttyh1-induced extracellular vesicles:

  • Expression system: Transfect Expi293 cells with C-terminally tagged Ttyh1 (e.g., Strep-tag) for efficient tracking and purification .

  • Vesicle isolation protocol:

    • Collect conditioned media (CM) from transfected cells

    • Concentrate CM through centrifugal filtration units

    • Purify vesicles using size exclusion chromatography

    • Validate purity through western blotting and dynamic light scattering

  • Characterization techniques:

    • Dynamic light scattering (DLS): Determination of vesicle size distribution

    • Transmission electron microscopy (TEM): Visualization of vesicle morphology and membrane tubulation

    • Protein-to-membrane quantification: Assessment of protein concentration in vesicle membranes

    • Cholesterol binding assays: Evaluation of membrane component interactions

For comparative studies between Ttyh1 and related proteins (e.g., Prom1), identical transfection conditions and purification protocols should be maintained to ensure valid comparisons of vesicle characteristics .

What behavioral assays are appropriate for evaluating cognitive effects in Ttyh1 knockout models?

Given Ttyh1's role in neural stem cell regulation and adult neurogenesis, several behavioral assays are recommended to evaluate cognitive and behavioral phenotypes in knockout models:

  • Morris water maze: This assay evaluates spatial learning and memory. The protocol involves:

    • 5 days of pre-training where mice learn to find a hidden platform in a circular pool

    • Training from 4 different quadrants with a 60-second time limit per trial

    • Probe trial on day 6 with platform removed to measure time spent in target quadrant

  • Open field test: This measures exploratory behavior and anxiety-like responses:

    • 5-minute recording period in a disinfected chamber

    • Parameters to measure: movement speed, total distance traveled, time spent in central versus peripheral areas

    • Environmental conditions must be strictly controlled to minimize external influences

  • BrdU incorporation studies: While not strictly behavioral, coupling BrdU administration with behavioral testing can correlate cognitive performance with neurogenesis rates:

    • Inject BrdU prior to behavioral testing

    • After testing, perform immunofluorescence analysis of brain sections

    • Correlate BrdU+ cell counts with behavioral metrics

When conducting these assessments, it's essential to use age-matched controls (6-8 weeks is recommended based on previous studies) and maintain consistent testing conditions to minimize variability .

What are the potential implications of Ttyh1 research for understanding neurodevelopmental disorders?

Ttyh1's regulatory role in neural stem cell maintenance through Notch signaling suggests potential relevance to neurodevelopmental disorders characterized by abnormal neurogenesis or neural circuit formation. Given that Ttyh1 knockout leads to enhanced neurogenesis , conditions involving premature differentiation of neural stem cells might involve Ttyh1 dysfunction.

The Notch signaling pathway, which Ttyh1 enhances, has been implicated in various neurodevelopmental disorders including:

  • Autism spectrum disorders

  • Intellectual disability

  • Neuronal migration disorders

Ttyh1's interaction with Rer1, which has known roles in the quality control of multiple membrane proteins including voltage-gated sodium channels , further suggests potential involvement in disorders of neuronal excitability. The enhanced membrane-bending properties of Ttyh1 and its role in extracellular vesicle formation may also have implications for disorders involving neuronal connectivity and intercellular communication.

How might modulating Ttyh1 activity affect adult neurogenesis in pathological conditions?

Since Ttyh1 knockout enhances neural stem cell proliferation and differentiation in adult neurogenic niches , strategic inhibition of Ttyh1 might represent a potential approach to stimulate endogenous neurogenesis in conditions characterized by decreased neurogenic capacity, such as:

  • Neurodegenerative disorders (Alzheimer's, Parkinson's disease)

  • Stroke recovery

  • Traumatic brain injury

  • The long-term consequences of sustained Ttyh1 inhibition on neural stem cell pool depletion

  • Potential effects on membrane dynamics and extracellular vesicle formation

  • Region-specific effects (as Ttyh1 knockout shows differential effects in SVZ versus SGZ)

  • Potential compensatory mechanisms involving other Ttyh family members

Developing conditional and inducible Ttyh1 knockout models would be valuable for assessing the temporal aspects of Ttyh1 inhibition on adult neurogenesis and cognitive function.

What emerging technologies could advance understanding of Ttyh1 function?

Several cutting-edge technologies offer promising approaches to further elucidate Ttyh1 biology:

  • Single-cell transcriptomics: Profiling gene expression changes in individual cells following Ttyh1 manipulation would reveal cell type-specific responses and potential compensatory mechanisms.

  • Cryo-electron microscopy: Determining the structural characteristics of Ttyh1 protein, particularly in membrane contexts, would advance understanding of its membrane-bending properties and potential differences from other Ttyh family members.

  • Optogenetic and chemogenetic tools: Developing means to spatiotemporally control Ttyh1 activity would allow assessment of acute versus chronic effects on neural stem cell dynamics.

  • In vivo imaging of extracellular vesicles: Technologies to track Ttyh1-induced EVs in living tissue would illuminate their potential roles in intercellular communication during brain development.

  • Reconstitution of Ttyh1 into artificial liposomes: This would enable precise manipulation of protein-to-lipid ratios and cholesterol content to dissect mechanisms underlying Ttyh1's membrane-bending properties .

What are unresolved questions about the evolutionary significance of Ttyh1?

Despite growing understanding of Ttyh1 function, several evolutionary aspects remain unexplored:

  • While Ttyh proteins have been proposed as distant homologs of prominins , the evolutionary relationship between these protein families requires further investigation, particularly regarding their shared membrane-bending properties.

  • The functional specialization of Ttyh1 compared to Ttyh2 and Ttyh3 raises questions about selective pressures that drove paralog diversification while maintaining similar structural features.

  • The absence of conserved cholesterol-binding motifs in Ttyh proteins, unlike prominins , suggests different evolutionary constraints on membrane interactions despite similar membrane-bending functions.

  • The evolutionary significance of Ttyh1's interaction with the Notch pathway, particularly in the context of brain size expansion across species, represents an intriguing area for comparative studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.