Recombinant Mouse Protein tyrosine phosphatase receptor type C-associated protein (Ptprcap)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Ptprcap; Protein tyrosine phosphatase receptor type C-associated protein; PTPRC-associated protein; CD45-associated protein; CD45-AP; LSM-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-197
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Ptprcap
Target Protein Sequence
MALPGTLRFGVLMALPGALASGADPEDGVGSSVVTIVLLLLLLLLLVTALALAWRRLSHA SGGYYHPARLGAALWGHTCRLLWASPAGRWLRARTELESPEESGPPEDEEDAEDFVIDGG PEEAAAKEEEQRCQAEQTRDPRDTDSDGGLGLSSQGPVGSGSSAEALLSDLHAFSGSAAW DDSAGGAGGQGLRVTAL
Uniprot No.

Target Background

Gene References Into Functions
  1. Studies on LPAP knockout thymocytes demonstrate that the interaction between LPAP and CD45 is not essential for CD45-mediated apoptosis signaling. PMID: 12055218
Database Links
Subcellular Location
Membrane; Single-pass membrane protein.
Tissue Specificity
Leukocyte-specific. Expressed in B- and T-cell lines, in spleen, thymus, and bone marrow of adult mice, and in embryos.

Q&A

What domains and structural motifs characterize Ptprcap protein?

Mouse Ptprcap contains several key structural elements:

  • A transmembrane domain (evident from the hydrophobic region in the sequence)

  • Cytoplasmic regions with potential phosphorylation sites

  • A specific CD45-binding interface

  • Potential glycosylation sites that contribute to its observed molecular weight being higher than calculated

The discrepancy between calculated (21 kDa) and observed (28-30 kDa) molecular weights in human PTPRCAP suggests significant post-translational modifications that likely also occur in the mouse protein .

What are the optimal conditions for handling and storing recombinant mouse Ptprcap?

For maximum stability and reproducibility in experiments, follow these guidelines:

Storage Conditions:

  • Store at -20°C for routine storage

  • For extended preservation, conserve at -80°C

  • Avoid repeated freeze-thaw cycles as this significantly reduces protein activity

  • Working aliquots can be maintained at 4°C for up to one week

Buffer Composition:

  • Typically supplied in Tris-based buffer with 50% glycerol

  • The buffer is optimized for this specific protein's stability

Methodological recommendation: Before initiating experiments, researchers should validate protein stability by running a small aliquot on SDS-PAGE to confirm integrity after storage.

What detection methods are most effective for Ptprcap in different experimental contexts?

The choice of detection method depends on the specific experimental question:

Detection MethodRecommended DilutionValidated SamplesMethodological Notes
Western Blot1:500-1:1000Jurkat cells, human spleenObserve at 28-30 kDa despite calculated 21 kDa
Immunohistochemistry1:50-1:500Human tonsillitis, lymphoma tissueUse TE buffer pH 9.0 for antigen retrieval
Immunofluorescence1:200-1:800Jurkat cellsUseful for subcellular localization
ELISAProtocol-dependentVaries by kitQuantitative measurement

For all applications, it is strongly recommended to titrate reagents in each specific testing system to obtain optimal results .

How can researchers validate the specificity and activity of recombinant Ptprcap?

Comprehensive validation requires multiple complementary approaches:

Functional Validation:

  • Co-immunoprecipitation with CD45/PTPRC to verify interaction capability

  • Assessment of CD45 phosphatase activity modulation in presence/absence of Ptprcap

  • Competitive binding assays with known peptide fragments

Structural Validation:

  • Circular dichroism to confirm proper protein folding

  • Size-exclusion chromatography to verify oligomeric state

  • Mass spectrometry to confirm expected molecular weight and modifications

Control Experiments:

  • Use heat-inactivated protein as negative control

  • Include blocking peptides in immunodetection experiments

  • Perform dose-response experiments to establish activity thresholds

For antibody validation specifically, pre-incubation with a 100x molar excess of the protein fragment control is recommended for blocking experiments .

What experimental approaches are most effective for studying Ptprcap-CD45 interactions?

Investigating this critical protein interaction requires specialized techniques:

In Vitro Binding Analysis:

  • Surface plasmon resonance (SPR) for measuring binding kinetics

  • Pull-down assays with recombinant proteins

  • ELISA-based interaction assays

Cellular Interaction Methods:

  • Co-immunoprecipitation from lymphocyte cell lysates

  • Proximity ligation assay in fixed cells

  • FRET/BRET approaches for real-time interaction monitoring

Structural Investigation:

  • Cryo-electron microscopy of the complex

  • Cross-linking mass spectrometry

  • NMR of interaction domains

For blocking experiments with antibodies, researchers should use the recombinant protein control fragment (such as human PTPRCAP aa 112-169) at a 100x molar excess based on antibody concentration and molecular weight, with 30-minute pre-incubation at room temperature .

How does Ptprcap modulate immune cell signaling pathways?

Ptprcap functions as a critical regulator in multiple immune signaling cascades:

T Cell Receptor (TCR) Signaling:

  • Helps position CD45 in proximity to the TCR complex

  • Influences the phosphorylation state of Src family kinases like Lck

  • Contributes to setting activation thresholds during T cell response

B Cell Receptor (BCR) Pathway:

  • Similar regulatory role in B lymphocytes

  • Modulates early signaling events following antigen recognition

  • May affect B cell selection mechanisms

Methodological considerations for investigation:

  • Use of phospho-specific antibodies to track signaling events

  • Complementary approaches combining biochemical assays with cellular readouts

  • Integration of proteomics data to map the complete signaling network

What is the significance of post-translational modifications in Ptprcap function?

Post-translational modifications explain the discrepancy between calculated (21 kDa) and observed (28-30 kDa) molecular weights :

Phosphorylation:

  • Multiple serine/threonine and tyrosine phosphorylation sites

  • Dynamically regulated during cellular activation

  • May create binding sites for other signaling proteins

Glycosylation:

  • Contributes significantly to the apparent molecular weight increase

  • May affect protein stability and half-life

  • Potentially influences interaction with binding partners

Methodological approaches to study PTMs:

  • Phosphatase/glycosidase treatment followed by mobility shift analysis

  • Mass spectrometry-based PTM mapping

  • Site-directed mutagenesis of modification sites

  • Phospho-specific antibodies when available

What are the current limitations in Ptprcap research models?

Researchers face several methodological challenges when studying Ptprcap:

Expression System Challenges:

  • Proper folding of recombinant protein requires specialized conditions

  • Baculovirus expression systems are often preferred for maintaining natural characteristics

  • Achieving physiologically relevant post-translational modifications is difficult

Model System Limitations:

  • Species differences between mouse and human proteins (33% identity) complicate translation of findings

  • Cell line models may not fully recapitulate primary cell behaviors

  • Knockout models may trigger compensatory mechanisms

Technical Obstacles:

  • Limited availability of highly specific antibodies for certain applications

  • Challenges in distinguishing direct vs. indirect effects in functional studies

  • Difficulties in reconstituting the native CD45-Ptprcap complex in vitro

How can researchers address conflicting data regarding Ptprcap function?

When faced with contradictory results, consider these methodological approaches:

Experimental Design Factors:

  • Different expression systems yield proteins with varying activity levels

  • Tag placement (N-terminal vs. C-terminal) may differentially affect function

  • Buffer conditions critically influence protein behavior

Reconciliation Strategies:

  • Directly compare different protein preparations in side-by-side experiments

  • Use multiple complementary techniques to validate key findings

  • Consider cell type-specific and context-dependent effects

  • Evaluate the impact of experimental conditions on protein behavior

When using commercial recombinant proteins, researchers should note key differences in production methods. For example, some preparations are expressed in Baculovirus systems with specific tags (N-terminal 10xHis-tag and C-terminal Myc-tag) , while others may use different expression systems or tag configurations.

How might Ptprcap research contribute to understanding immune disorders?

Investigating Ptprcap has potential implications for several disease areas:

Autoimmune Disease Connections:

  • Aberrant CD45-Ptprcap interactions may contribute to dysregulated T cell activation

  • Polymorphisms in PTPRCAP could affect disease susceptibility or progression

  • Targeting this interaction might offer novel immunomodulatory approaches

Cancer Immunology Applications:

  • Role in tumor-infiltrating lymphocyte function and activity

  • Potential biomarker for certain hematological malignancies

  • Target for enhancing anti-tumor immune responses

Methodological considerations for disease-focused research:

  • Integration with clinical datasets and patient samples

  • Correlation of expression patterns with disease parameters

  • Development of conditional models for tissue-specific manipulation

What novel experimental approaches are emerging for Ptprcap research?

Advanced technologies are expanding research possibilities:

Single-Cell Analysis:

  • Examining Ptprcap expression and function at single-cell resolution

  • Correlating with cell activation states and phenotypic transitions

  • Integration with spatial transcriptomics for tissue context

CRISPR-Based Approaches:

  • Precise gene editing for functional domain analysis

  • Creation of reporter systems for monitoring protein dynamics

  • Development of conditional knockout models for tissue-specific studies

Structural Biology Advances:

  • Cryo-EM characterization of the CD45-Ptprcap complex

  • Hydrogen-deuterium exchange mass spectrometry for interaction mapping

  • Computational modeling and molecular dynamics simulations

Such emerging approaches will help resolve contradictions in existing literature and provide deeper insights into the fundamentals of Ptprcap biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.