Recombinant Mouse Protein unc-50 homolog (Unc50)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Unc50; Protein unc-50 homolog; Periodontal ligament-specific protein 22; PDLs22
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-259
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Unc50
Target Protein Sequence
MLPSTSLSSSMHGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSP QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVFI DCVGVGLLISTLMWFVSNKYLVKRQSRDYDVEWGYAFDVHLNAFYPLLVILHFIQLFFIN HVILTDTFIGYLVGNTLWLIAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLMVLYGLSL ALGWNFTHTLCSFYKYRVK
Uniprot No.

Target Background

Function

Involved in the cell surface expression of neuronal nicotinic receptors. It also exhibits RNA-binding capabilities.

Database Links
Protein Families
Unc-50 family
Subcellular Location
Nucleus inner membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.
Tissue Specificity
Highly expressed in periodontal ligament and bone marrow, but not in gingival fibroblasts.

Q&A

What is UNC50 and what are its known synonyms?

UNC50 (unc-50 homolog) is a transmembrane protein that plays a crucial role in cellular trafficking pathways. The protein has been identified by various names in the literature, including GMH1, UNCL, URP, hGMH1, PDLs22, unc-50 related, protein GMH1 homolog, uncoordinated-like protein, periodontal ligament-specific protein 22, and geal-6 membrane-associated high-copy suppressor 1 (HSD2) . When designing experiments or conducting literature searches, researchers should account for these alternative designations to ensure comprehensive coverage of existing knowledge.

What is the basic structural organization of UNC50?

UNC50 is characterized by a structure containing five transmembrane domains . The transmembrane organization is critical for its localization and function within the cell. Previous studies have demonstrated that UNC50 is primarily localized to the Golgi apparatus, which is consistent with its role in intracellular trafficking pathways . The protein's membrane topology positions it ideally to facilitate protein transport between cellular compartments, particularly between early endosomes and the Golgi network.

What protein interactions have been identified for UNC50?

UNC50 has been shown to interact with several proteins, including CREB3, GEA1, Tuba3a, and ENTHD2 . These interactions suggest UNC50 may function within a complex network of proteins involved in membrane trafficking and cellular signaling. When designing experiments to investigate UNC50 function, researchers should consider these interactions and potentially include co-immunoprecipitation or proximity ligation assays to verify and further characterize these relationships in their experimental system.

What approaches can be used to generate UNC50 knockout models?

CRISPR-Cas9 technology has been successfully employed to generate UNC50 knockout cell lines. In previous research, a lentivirus-based CRISPR system was used to introduce stop codons in or immediately after the region coding for the second transmembrane domain of UNC50 . This approach resulted in premature termination of transcription, effectively inactivating the protein. Researchers validated the knockout by RT-PCR analysis using primers designed to amplify regions upstream and downstream of the introduced stop codons . A successful knockout should show positive PCR product for upstream regions but negative results for downstream regions, confirming the effective termination of transcription at the engineered stop codons.

How can researchers validate UNC50 depletion in experimental models?

Validation of UNC50 depletion presents unique challenges due to limitations in available commercial antibodies. When commercial antibodies fail to reliably detect endogenous UNC50, researchers can employ alternative validation strategies:

  • RT-PCR analysis to confirm transcription termination at engineered stop codons

  • Transient transfection with CRISPR-sensitive or CRISPR-resistant myc-tagged UNC50 constructs

  • Functional assays to demonstrate altered cellular phenotypes consistent with UNC50 depletion

In previous studies, researchers observed substantially lower expression of CRISPR-sensitive myc-UNC50 in knockout cells compared to wild-type cells, while expression of control constructs and CRISPR-resistant myc-tagged UNC50 remained unaffected or even increased . These approaches provide robust validation of successful UNC50 depletion.

How does UNC50 regulate Shiga toxin trafficking and what experimental models are appropriate for investigation?

UNC50 plays a critical role in the trafficking of Shiga toxin 2 (STx2) but interestingly not Shiga toxin 1 (STx1). A genome-wide siRNA screen identified UNC50 as specifically required for STx2 toxicity, with depletion of UNC50 protecting cells against STx2-induced cell death but not against STx1 . This finding was supported by evidence that UNC50 depletion blocks early endosome-to-Golgi trafficking of STx2, redirecting the toxin to lysosomes for degradation.

When designing experiments to investigate this pathway, researchers should consider:

  • Using both STx1 and STx2 as controls to demonstrate the specificity of UNC50 effects

  • Including trafficking assays to visualize and quantify toxin movement through cellular compartments

  • Incorporating lysosomal inhibitors to confirm the redirection of trafficking to the degradative pathway

  • Designing rescue experiments with wild-type UNC50 expression to confirm specificity

This experimental paradigm can be extended to investigate other cargo proteins that might depend on UNC50 for proper trafficking.

What detection methods are available for studying UNC50 in experimental samples?

Several methods are available for detecting and studying UNC50 in research settings:

Each method has advantages and limitations that should be considered when designing experiments.

What are common challenges in UNC50 research and how can they be addressed?

Several challenges may arise when studying UNC50:

  • Antibody specificity issues: Commercial antibodies may not reliably detect endogenous UNC50. Researchers should validate antibodies using positive and negative controls, including UNC50 knockout cells or tissues. Alternative strategies include using epitope-tagged constructs or detecting UNC50 at the mRNA level.

  • Functional redundancy: UNC50 depletion may trigger compensatory mechanisms involving related proteins. Researchers should consider examining expression levels of functionally related proteins to identify potential compensatory responses.

  • Distinguishing direct vs. indirect effects: As UNC50 plays a role in cellular trafficking, its depletion may have wide-ranging consequences. To distinguish direct from indirect effects, rescue experiments with wild-type UNC50 should be performed, and acute depletion methods (e.g., auxin-inducible degron systems) can minimize adaptive responses.

  • Transient vs. stable depletion: Differences may exist between phenotypes observed with transient siRNA-mediated knockdown versus stable CRISPR-based knockout. Both approaches should be considered for a comprehensive understanding of UNC50 function.

How can researchers quantify UNC50-dependent trafficking defects?

When analyzing UNC50-dependent trafficking defects, several quantitative approaches can be employed:

  • Colocalization analysis: Measuring the colocalization of cargo proteins with organelle markers (e.g., early endosome, Golgi, lysosome) in control versus UNC50-depleted cells.

  • Pulse-chase assays: Quantifying the kinetics of cargo trafficking through different compartments over time.

  • Cell viability assays: For toxins like STx2, measuring cell survival as a functional readout of trafficking.

  • Biochemical fractionation: Isolating subcellular compartments and quantifying the distribution of cargo proteins across fractions.

The choice of quantification method should align with the specific trafficking pathway being investigated and the available technical resources.

How might UNC50 function be exploited for therapeutic development?

The finding that UNC50 depletion protects cells against Shiga toxin 2-induced cytotoxicity suggests potential therapeutic applications. Shiga toxin-producing Escherichia coli (STEC) infections, particularly those producing STx2, are associated with hemolytic uremic syndrome and significant morbidity and mortality . Targeting UNC50 or its associated trafficking pathway could represent a novel therapeutic strategy for STEC infections.

Researchers exploring this direction should consider:

  • Developing small molecule inhibitors of UNC50 function

  • Investigating the spectrum of pathogens and toxins that rely on UNC50-dependent trafficking

  • Assessing potential side effects of UNC50 inhibition on normal cellular physiology

  • Exploring tissue-specific targeting strategies to minimize off-target effects

What is known about UNC50 across different species and experimental models?

UNC50 is evolutionarily conserved, with homologs identified across multiple species. The protein was originally characterized in Caenorhabditis elegans, and homologs have been studied in various organisms including humans, mice, and yeast . This conservation suggests fundamental importance in cellular function.

A comparative analysis of UNC50 function across species may reveal both conserved and species-specific roles. Researchers investigating UNC50 should consider:

  • Cross-species complementation experiments to assess functional conservation

  • Comparative analysis of UNC50 interaction partners across species

  • Phenotypic analysis of UNC50 depletion in different model organisms

  • Potential adaptation of UNC50 function to species-specific cellular processes

This comparative approach can provide insights into the fundamental versus specialized functions of UNC50 across evolution.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.