Recombinant Mouse Protein YIF1B (Yif1b)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Mouse Protein YIF1B (Yif1b)

Recombinant Mouse Protein YIF1B (Yif1b) is a synthetic version of the endogenous YIF1B protein, a multi-pass membrane protein belonging to the YIF1 family. It plays critical roles in endoplasmic reticulum (ER)/Golgi trafficking and dendritic targeting of serotonin receptors in neurons . This recombinant protein is engineered for research purposes, enabling precise studies of its biochemical functions and therapeutic potential.

ELISA Kits for Quantification

The Mouse YIF1B ELISA Kit (MOEB1429) enables precise quantification of YIF1B in serum, plasma, and tissue lysates :

ELISA Kit DetailsSpecification
Detection Range0.156–10 ng/mL
Sensitivity0.066 ng/mL
Sample TypesSerum, plasma, tissue homogenates, cell culture supernates
ReactivityMouse YIF1B (natural and recombinant)

Key Experimental Findings

  • siRNA-Mediated Knockdown: Inhibition of endogenous YIF1B in neurons prevents 5-HT1AR dendritic localization, confirming its necessity for receptor trafficking .

  • GST Pull-Down Assays: Confirmed direct interaction between YIF1B and the 5-HT1AR C-terminus in rat brain extracts and transfected cell lines .

  • Colocalization Studies: YIF1B and 5-HT1AR colocalize in small vesicles during intracellular transport, supporting their functional partnership .

Therapeutic and Biomarker Potential

YIF1B is implicated in neurological disorders and depression, as its dysregulation may affect serotonin signaling. Recombinant YIF1B serves as a tool for:

  1. Drug Development: Identifying compounds that modulate YIF1B-5-HT1AR interactions to enhance antidepressant efficacy .

  2. Biomarker Research: ELISA-based quantification of YIF1B levels in disease models .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing the order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by factors including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize its development.
Synonyms
Yif1b; Protein YIF1B; YIP1-interacting factor homolog B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-311
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Yif1b
Target Protein Sequence
MHATGLAAPAGTPRLRKWPSKRRVPVSQPGMADPHQFFDDTSSAPSRGYGGQPSPGGLGY PPSSSDAAFLAAPMSNMAMVYGSSLAAQGKELVDKNIDRFIPVSKLKYYFAVDTVYVGKK LGLLVFPYLHQDWEVQYQQDTPVAPRFDINAPDLYIPAMAFITYILVAGLALGTQDRFSP DLLGLQASSALAWLTLEVVAILLSLYLVTVNTDLTTIDLVAFLGYKYVGMIGGVLTGLLF GKIGYYLVLAWCCVSIFVFMIRTLRLKILAQAAAEGVPVRGARNQLRMYLTMAVAAAQPV LMYWLTFHLVR
Uniprot No.

Target Background

Function
YIF1B plays a crucial role in the anterograde trafficking pathway from the endoplasmic reticulum to the plasma membrane and the organization of Golgi architecture. It is a key factor in targeting receptors, such as HTR1A, to neuronal dendrites.
Gene References Into Functions
  1. Depletion of YIF1B disrupts Golgi architecture and anterograde traffic. PMID: 26077767
Database Links
Protein Families
YIF1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein.

Q&A

What is Mouse Protein YIF1B and what cellular functions does it mediate?

Mouse Protein YIF1B is encoded by the YIF1B gene and plays critical roles in intracellular trafficking pathways. Specifically, YIF1B functions in anterograde transport from the endoplasmic reticulum to the cell membrane and maintains proper Golgi apparatus morphology . Research has demonstrated that YIF1B is essential for early post-natal neurodevelopment, as mutations in this gene lead to neurodevelopmental disorders characterized by global developmental delay, motor delay, and visual deficits with brain abnormalities .

Methodological approach: To investigate YIF1B cellular functions, researchers can utilize subcellular fractionation techniques combined with immunofluorescence microscopy to visualize its localization within the secretory pathway. Co-localization studies with organelle markers (e.g., calnexin for ER, GM130 for Golgi) provide insights into its distribution and trafficking roles.

How does YIF1B contribute to primary cilium formation despite not being detected within the cilium itself?

While YIF1B protein is not directly detected within primary cilia, research has revealed that biallelic YIF1B mutations cause significant primary cilia abnormalities in both patient-derived skin fibroblasts and tissues from Yif1b knockout mice . This unexpected finding establishes a functional connection between disorders affecting the Golgi apparatus (Golgipathies) and ciliopathies.

Methodological approach: To study this relationship, researchers should examine ciliary architecture using antibodies against ciliary components (acetylated tubulin, ARL13B) in combination with super-resolution microscopy. Quantitative analysis of cilium length, frequency, and morphology in control versus YIF1B-deficient cells provides insights into YIF1B's indirect role in ciliogenesis.

What detection methods are available for measuring Mouse Protein YIF1B in biological samples?

Several analytical techniques can be employed to detect and quantify YIF1B in experimental samples:

Detection MethodSample TypesSensitivityApplications
ELISASerum, plasma, tissue homogenates, cell culture supernatantsHigh (pg/ml range)Quantitative measurement of YIF1B levels
Western BlottingCell/tissue lysatesMediumProtein expression and molecular weight confirmation
ImmunohistochemistryTissue sectionsMedium-HighSpatial distribution within tissues
ImmunofluorescenceCultured cells, tissue sectionsHighSubcellular localization
Mass SpectrometryPurified protein, complex samplesVery HighProtein identification, post-translational modifications

Methodological approach: For optimal detection, sample preparation should include protease inhibitors to prevent degradation. Validation of antibody specificity using YIF1B knockout controls is essential for reliable results.

What phenotypic abnormalities are observed in Yif1b knockout mouse models?

Yif1b knockout (KO) mice display a constellation of neurodevelopmental abnormalities that parallel the clinical features observed in human patients with YIF1B mutations. These include:

  • Neuronal reduction

  • Altered myelination of the motor cortex

  • Cerebellar atrophy

  • Ventricle enlargement

  • Subcellular alterations in endoplasmic reticulum and Golgi apparatus compartments

  • Primary cilia abnormalities

Methodological approach: When characterizing Yif1b KO phenotypes, researchers should employ a multidisciplinary approach including histological analysis, electron microscopy for ultrastructural examination, immunohistochemistry for neural markers, and behavioral testing to correlate structural abnormalities with functional outcomes.

How can researchers effectively design rescue experiments to validate YIF1B function in knockout models?

Rescue experiments provide crucial evidence for the specificity of observed phenotypes to YIF1B loss.

Methodological approach:

  • Generate expression constructs containing wild-type YIF1B under appropriate promoters (constitutive or inducible)

  • Create domain-specific mutants to identify functional regions essential for rescue

  • Develop tissue-specific or temporally regulated expression systems to determine critical periods for YIF1B function

  • Establish quantifiable readouts (e.g., ciliary architecture, Golgi morphology, trafficking efficiency)

  • Apply statistical methods to determine the degree of phenotypic rescue across multiple parameters

Research findings suggest that reintroduction of functional YIF1B can potentially rescue cellular defects, making this approach valuable for both mechanistic studies and therapeutic development.

What strategies can be employed to study the dynamic trafficking functions of YIF1B in living cells?

Understanding the real-time dynamics of YIF1B-mediated trafficking requires specialized approaches:

Methodological approach:

  • Generate fluorescently tagged YIF1B constructs (e.g., YIF1B-GFP) for live-cell imaging

  • Implement pulse-chase experiments with cargo proteins to track trafficking kinetics

  • Apply photoactivatable or photoconvertible tags to monitor specific protein populations

  • Utilize FRAP (Fluorescence Recovery After Photobleaching) to measure protein mobility

  • Employ the RUSH (Retention Using Selective Hooks) system to synchronize cargo release from the ER

These approaches allow researchers to quantitatively assess how YIF1B manipulation affects the speed, directionality, and efficiency of protein trafficking through the secretory pathway.

What considerations are important when reconstituting and storing recombinant Mouse YIF1B protein?

Based on protocols for similar recombinant mouse proteins, optimal handling of recombinant YIF1B includes:

ParameterRecommendationNotes
Reconstitution BufferPBS (phosphate-buffered saline)For carrier-free preparations
Reconstitution Concentration100 μg/mLAdjust based on experimental requirements
Storage Temperature (lyophilized)-20°C to -80°CProtect from moisture
Storage Temperature (reconstituted)-80°C (long-term)Prepare working aliquots
Freeze-Thaw CyclesMinimizeEach cycle can reduce activity
Working Temperature4°CFor short-term use only

Methodological approach: Validate protein activity after reconstitution using functional assays specific to YIF1B's known biological activities, such as effects on ER-to-Golgi trafficking or binding to known interaction partners.

How should researchers approach the development of functional assays for recombinant YIF1B?

Developing reliable functional assays is essential for confirming the activity of recombinant YIF1B.

Methodological approach:

  • Establish cellular systems with YIF1B deficiency (siRNA knockdown or CRISPR knockout)

  • Identify quantifiable phenotypes (e.g., Golgi fragmentation, trafficking delays, cilia defects)

  • Develop dose-response studies to determine the effective concentration range

  • Include proper controls (heat-inactivated protein, unrelated recombinant proteins)

  • Implement both acute (immediate) and chronic (long-term) supplementation protocols

Complementation assays in which recombinant YIF1B is introduced into YIF1B-deficient cells provide the most direct measure of functional activity.

What experimental approaches can determine the interaction network of YIF1B?

Understanding YIF1B's protein interactions provides insights into its molecular function.

Methodological approach:

  • Co-immunoprecipitation (Co-IP) with antibodies against YIF1B or tagged recombinant versions

  • Proximity labeling techniques (BioID, APEX) to identify proximal proteins in living cells

  • Yeast two-hybrid screening to identify direct binding partners

  • Label-free protein interaction analysis (Surface Plasmon Resonance, Isothermal Titration Calorimetry)

  • Cross-linking mass spectrometry to capture transient interactions during trafficking events

Research should prioritize validating key interactions through multiple independent methods and determining their functional significance through targeted disruption experiments.

How can researchers distinguish between direct and indirect consequences of YIF1B dysfunction?

Differentiating primary effects from secondary adaptations presents a significant challenge in YIF1B research.

Methodological approach:

  • Implement acute depletion systems (e.g., auxin-inducible degron) to observe immediate consequences

  • Perform time-course analyses to identify the temporal sequence of cellular changes

  • Utilize domain-specific mutations to link particular functions to specific phenotypes

  • Conduct parallel analyses across multiple cell types with varying dependence on YIF1B

  • Apply systems biology approaches to model pathway perturbations

Researchers should be particularly attentive to compensatory mechanisms that may mask or modify phenotypes in long-term knockout models.

What statistical considerations are important when analyzing complex phenotypes in YIF1B mutant models?

The multifaceted nature of YIF1B-related phenotypes requires robust statistical approaches.

Methodological approach:

  • Determine appropriate sample sizes through power analysis before beginning experiments

  • Implement multivariate statistical methods to capture relationships between interdependent phenotypes

  • Account for potential confounding variables (sex, age, genetic background)

  • Apply appropriate corrections for multiple testing when analyzing high-dimensional datasets

  • Consider hierarchical or mixed-effects models for nested experimental designs

  • Conduct blinded analyses to prevent observer bias

Careful statistical planning and transparent reporting of analytical methods enhances the reproducibility and interpretability of YIF1B research findings.

What are the critical controls needed when evaluating YIF1B's role in neurodevelopmental processes?

Methodological approach:

  • Include littermate controls to minimize genetic background effects

  • Compare homozygous and heterozygous models to assess gene dosage effects

  • Implement rescue experiments with wild-type YIF1B to confirm phenotype specificity

  • Include developmental time-course analyses to establish normal expression patterns

  • Utilize tissue-specific knockout models to isolate cell-autonomous effects

  • Examine multiple brain regions to distinguish region-specific from global effects

Researchers should be particularly careful to distinguish developmental defects from acute functional requirements through appropriately timed interventions.

How can findings from mouse YIF1B studies inform understanding of human neurodevelopmental disorders?

Translating results from mouse models to human pathology requires careful consideration of species differences.

Methodological approach:

  • Compare phenotypes in mouse models with clinical features in human patients with YIF1B mutations

  • Utilize patient-derived cells (e.g., fibroblasts, induced pluripotent stem cells) for parallel studies

  • Focus on conserved cellular mechanisms rather than species-specific phenotypes

  • Consider differences in developmental timing between mouse and human

  • Validate key findings across multiple model systems when possible

The striking similarities between YIF1B-deficient mouse models and human patients with YIF1B mutations suggest that mechanistic insights from mouse studies may have direct relevance to human disease .

What experimental approaches can assess potential therapeutic strategies targeting the YIF1B pathway?

Developing interventions for YIF1B-related disorders requires specialized experimental approaches.

Methodological approach:

  • Screen for small molecules that can modulate trafficking through the secretory pathway

  • Evaluate gene therapy approaches for delivery of functional YIF1B

  • Test interventions targeting downstream effectors of YIF1B dysfunction

  • Develop assays for high-throughput screening of compound libraries

  • Establish quantifiable biomarkers for monitoring treatment efficacy

Early intervention may be particularly critical given the developmental nature of YIF1B-associated disorders, suggesting a need for prenatal or early postnatal therapeutic strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.