Recombinant Mouse Protein YIPF2 (Yipf2)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Mouse Protein YIPF2 (Yipf2)

Recombinant Mouse Protein YIPF2 (Yipf2) is a laboratory-engineered version of the Yip1 domain family member 2 protein, produced using heterologous expression systems such as E. coli, yeast, baculovirus, or mammalian cells . This protein plays critical roles in intracellular trafficking, apoptosis regulation, and genome stability, as evidenced by studies on its endogenous counterpart in murine and human models[1–4]. Its recombinant form enables controlled experimental studies to dissect molecular mechanisms in disease contexts.

Research Applications and Functional Insights

Recombinant Mouse YIPF2 is utilized to investigate:

  • Vesicle Trafficking: Modulates endocytic recycling of transmembrane proteins (e.g., CD147, TNFRSF10B) by regulating Rab GTPase activity .

  • Apoptosis Regulation: Enhances cell surface retention of TNFRSF10B, promoting chemotherapeutic agent-induced apoptosis in cancer cells .

  • Genome Stability: Maintains homologous recombination (HR) repair efficiency and reduces replication stress .

Role in Apoptosis and Cancer Therapy

  • YIPF2 overexpression increases TNFRSF10B recycling to the plasma membrane, sensitizing non-small-cell lung cancer (NSCLC) cells to chemotherapy-induced apoptosis .

  • Depletion of YIPF2 reduces TNFRSF10B surface levels, correlating with poor survival in lung adenocarcinoma patients .

Genome Integrity Maintenance

  • YIPF2 deficiency impairs HR repair by reducing phosphorylated BRCA1 and RAD51 levels, leading to DNA replication stress and R-loop accumulation .

  • Overexpression rescues γH2A.X foci formation and delays cellular senescence in DNA damage models .

Trafficking in Hepatocellular Carcinoma (HCC)

  • Acts as a Rab-GDF (GDI-displacement factor) for Rab5/Rab22a, controlling CD147 glycosylation and endocytic recycling .

  • Knockdown enhances HCC cell migration and invasion by increasing matrix metalloproteinase (MMP) secretion .

Future Directions and Implications

Recombinant Mouse YIPF2 serves as a pivotal tool for:

  1. Developing targeted therapies to modulate apoptosis in chemotherapy-resistant cancers.

  2. Exploring genome stability mechanisms in aging and carcinogenesis.

  3. Designing inhibitors against Rab-YIPF2 interactions to block metastatic pathways in HCC.

Current research gaps include structural studies of YIPF2-Rab complexes and tissue-specific trafficking roles. Collaborative efforts between protein engineers and oncologists could accelerate translational applications[1–5].

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes if needed. We will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Yipf2; Protein YIPF2; YIP1 family member 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-312
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Yipf2
Target Protein Sequence
MAAADELAFHEFEEATNLLAETPDAATTSQSDELTSREHVAVVVGSGIGYGAEVGEEEDD KTSLLQEEKPQPRFWTFDYYQSFFDVDTSQVLDRIKGSLLPHPGHNFVRHHLRNRPDLYG PFWICATLAFVLAVTGNLTLVLAQRRDPSIHYSPQFHKVTIAGITIYCYAWLVPLALWGF LRWRQGTRERMGLYTFLETVCVYGYSLFVFIPTVVLWLIPVQWIQWLFGALGLALSAAGL VFTLWPVVREDTRLVAAALLSTVVLLHALLALGCKLYFFQPLPLDHVVPAPQATPPSPNV LLPSSIQPMTTS
Uniprot No.

Target Background

Database Links
Protein Families
YIP1 family
Subcellular Location
Golgi apparatus, cis-Golgi network membrane; Multi-pass membrane protein. Golgi apparatus, trans-Golgi network membrane. Late endosome membrane.

Q&A

What is the basic structure of mouse YIPF2 protein?

YIPF2 is a member of the YIP (Ypt-interacting protein) family, which refers to proteins that interact with RAB GTPases. The YIPF2 protein contains five predicted transmembrane segments with an N-terminal domain exposed to the cytoplasm and a short C-terminal domain exposed to the lumen of the secretory pathway . This structural arrangement facilitates its function in membrane trafficking and protein transport. The protein's multiple transmembrane domains allow it to be embedded in the Golgi membrane while facilitating interactions with transport vesicles and cargo proteins. Understanding this basic structure is essential for designing expression constructs and developing effective antibodies for detection in experimental systems.

What are the primary cellular locations and functions of YIPF2?

YIPF2 is primarily localized in the medial-/trans-Golgi network (TGN) compartments . It co-localizes with various RAB proteins, suggesting its involvement in vesicular transport mechanisms . Functionally, YIPF2 is predicted to enable small GTPase binding activity and is involved in vesicle-mediated transport processes that are essential for cellular homeostasis . It serves as a GDI-displacement factor (GDF) for certain RAB proteins, including RAB5 and RAB22A, thereby catalyzing the dissociation of RAB-GDI complexes . This activity regulates protein trafficking and recycling pathways that are critical for maintaining cellular functions. The protein's precise localization can be visualized using immunofluorescence techniques with specific antibodies against YIPF2 in conjunction with established Golgi markers.

How does mouse YIPF2 differ from human YIPF2 in terms of sequence homology and function?

While the search results don't explicitly compare mouse and human YIPF2, understanding species differences is important for translational research. Both human and mouse YIPF2 proteins function as members of the YIP family and localize to the Golgi apparatus. Sequence alignment analyses typically show high conservation between mammalian orthologs of YIPF2, suggesting functional conservation across species. When designing experiments using recombinant mouse YIPF2 with the intention of translating findings to human systems, researchers should account for any potential species-specific differences in protein-protein interactions or post-translational modifications. Cross-species rescue experiments can be particularly informative, where mouse YIPF2 is expressed in human cells with YIPF2 knockdown to determine functional complementation.

What are the recommended methods for detecting recombinant mouse YIPF2 in experimental systems?

For detecting recombinant mouse YIPF2 in experimental systems, researchers should consider multiple complementary approaches. Western blotting is effective for quantifying YIPF2 protein levels in cell lysates following overexpression or knockdown experiments, as demonstrated in studies examining YIPF2's role in apoptosis . Immunofluorescence microscopy is particularly valuable for determining subcellular localization patterns, especially co-localization with Golgi markers and RAB proteins . For protein interaction studies, co-immunoprecipitation (co-IP) assays have successfully demonstrated YIPF2's physical interactions with proteins like RAB8 and TNFRSF10B . When using tagged recombinant YIPF2 constructs (such as FLAG-tagged or GFP-fusion proteins), researchers should verify that the tag doesn't interfere with protein localization or function through appropriate control experiments.

What techniques are most effective for studying YIPF2 protein-protein interactions?

Co-immunoprecipitation (co-IP) assays have proven effective for investigating YIPF2's interactions with partner proteins. Research has successfully used this technique to demonstrate that YIPF2 physically interacts with TNFRSF10B and RAB8 . When designing co-IP experiments, researchers should consider using both approaches: immunoprecipitating YIPF2 to detect binding partners and immunoprecipitating suspected partners to detect YIPF2. For instance, studies have shown that YIPF2 can inhibit the interaction between TNFRSF10B and RAB8, which affects TNFRSF10B trafficking and cell surface expression .

Additional techniques that complement co-IP include proximity ligation assays (PLA) for detecting protein interactions in situ, and fluorescence resonance energy transfer (FRET) for studying dynamic interactions in living cells. Mass spectrometry following affinity purification can also identify novel interaction partners of YIPF2 in an unbiased manner. When reporting interaction studies, researchers should include appropriate controls to exclude non-specific binding artifacts.

How can researchers effectively overexpress or knock down YIPF2 in mouse cell models?

For overexpression studies, researchers have successfully used plasmid constructs like pEGFP-N1-YIPF2 for expressing tagged YIPF2 protein . When designing expression constructs, consideration should be given to the position of tags (N- or C-terminal) to minimize interference with protein function or localization. For transient transfection, lipid-based reagents have proven effective in various cell lines including NSCLC cells .

For knockdown experiments, siRNA or shRNA approaches targeting YIPF2 have been successfully implemented . When designing RNA interference experiments, researchers should validate knockdown efficiency at both mRNA level (using RT-qPCR) and protein level (using western blot). Multiple independent siRNA sequences should be tested to confirm phenotypes and rule out off-target effects. For long-term studies, stable cell lines with inducible YIPF2 expression or CRISPR/Cas9-mediated knockout systems may provide more consistent results than transient approaches. Control experiments should include rescue assays where recombinant YIPF2 is reintroduced to confirm phenotype specificity.

How does YIPF2 regulate vesicular transport in the Golgi apparatus?

YIPF2 plays a critical role in vesicular transport through its localization in the medial-/trans-Golgi network and interactions with RAB GTPases . It functions as part of the machinery controlling membrane trafficking between the Golgi and other cellular compartments. Specifically, YIPF2 acts as a GDI-displacement factor (GDF) for certain RAB proteins, catalyzing the dissociation of RAB-GDI complexes . This activity is essential for the cycling of RAB proteins between their active membrane-bound and inactive cytosolic forms, which in turn regulates vesicle formation, motility, and fusion.

Research methodologies to study this function include subcellular fractionation to isolate Golgi-enriched membranes, live cell imaging with fluorescently tagged YIPF2 and cargo proteins, and electron microscopy to examine ultrastructural changes in Golgi morphology following YIPF2 manipulation. Transport assays using temperature-sensitive cargo proteins can quantitatively measure the effect of YIPF2 on trafficking rates between the Golgi and plasma membrane or endosomes.

What is the relationship between YIPF2 and RAB GTPases in membrane trafficking?

YIPF2 interacts with multiple RAB GTPases, particularly RAB8, which is involved in membrane traffic between the trans-Golgi network and the basolateral plasma membrane . Co-immunoprecipitation studies have confirmed direct physical interactions between YIPF2 and RAB8 . Functionally, YIPF2 can modulate the activity of certain RAB proteins by serving as a GDI-displacement factor, promoting their activation at specific membrane compartments .

The YIPF2-RAB interaction has significant functional consequences for membrane trafficking pathways. For example, YIPF2 can inhibit the interaction between RAB8 and TNFRSF10B, thereby suppressing the removal of TNFRSF10B from the plasma membrane to the cytoplasm . This mechanism helps maintain high levels of TNFRSF10B on the cell surface, which has implications for apoptotic signaling pathways.

Researchers studying these interactions should employ multiple approaches, including in vitro binding assays with purified proteins, GTPase activity assays to determine how YIPF2 affects RAB activation state, and live cell imaging to track the dynamics of these interactions in real time.

How does YIPF2 contribute to protein recycling between cellular compartments?

YIPF2 plays a significant role in protein recycling between cellular compartments, particularly in enhancing the recycling of certain proteins to the plasma membrane. Research has shown that YIPF2 promotes TNFRSF10B recycling to the plasma membrane in non-small cell lung cancer cells . Flow cytometry analysis revealed that overexpression of YIPF2 increased the levels of TNFRSF10B on the plasma membrane, while knockdown of YIPF2 decreased its surface expression .

This recycling function appears to be mediated through YIPF2's ability to inhibit the interaction between TNFRSF10B and RAB8, which normally mediates the removal of TNFRSF10B from the plasma membrane to the cytoplasm . By interfering with this interaction, YIPF2 maintains higher levels of TNFRSF10B on the cell surface. Additionally, YIPF2 enhances the stability of TNFRSF10B protein, as demonstrated by cycloheximide chase experiments .

Similar mechanisms may apply to other cargo proteins, suggesting YIPF2 has a broader role in regulating protein homeostasis at the cell surface. For researchers investigating these pathways, techniques such as biotinylation assays to track surface protein internalization and recycling, along with live-cell imaging of fluorescently tagged cargo proteins, provide valuable insights into the dynamics of these processes.

What role does YIPF2 play in cancer progression and response to chemotherapy?

Research indicates that YIPF2 has significant implications in cancer biology, particularly in non-small cell lung cancer (NSCLC). YIPF2 promotes chemotherapeutic agent-mediated apoptosis by enhancing TNFRSF10B recycling to the plasma membrane in NSCLC cells . The expression of YIPF2 is upregulated following treatment with chemotherapeutic agents such as pemetrexed (PEM) and doxorubicin (DOX) . This upregulation enhances the apoptotic response to these drugs by increasing the surface expression of death receptors like TNFRSF10B.

Bioinformatic analyses have revealed that the YIPF2-TNFRSF10B axis is associated with malignant progression of lung cancer . Lower expression of YIPF2 is observed in lung adenocarcinoma tissues compared to normal tissues . Furthermore, higher expression of YIPF2 correlates with better survival outcomes in chemotherapy-treated patients, including improved first-progression survival and post-progression survival .

Methodologically, researchers investigating YIPF2's role in cancer should employ a combination of in vitro cell culture systems, patient-derived xenograft models, and analysis of clinical datasets. Flow cytometry to measure death receptor surface expression, apoptosis assays including caspase activation measurements, and animal models to assess tumor response to chemotherapy in the context of YIPF2 manipulation provide comprehensive insights into this protein's therapeutic implications.

How does YIPF2 influence apoptotic pathways in response to cellular stress?

YIPF2 plays a crucial role in promoting apoptosis, particularly through the extrinsic death receptor-induced pathway . When NSCLC cells are treated with chemotherapeutic agents like PEM, YIPF2 expression increases, leading to enhanced apoptotic responses . Mechanistically, YIPF2 promotes apoptosis by increasing the levels of TNFRSF10B (a death receptor) on the cell surface, which facilitates death ligand binding and subsequent activation of apoptotic cascades .

Overexpression of YIPF2 in NSCLC cells increases the cleavage of CASP8, CASP3, and PARP1, which are markers of extrinsic apoptosis pathway activation . Conversely, knockdown of YIPF2 expression decreases the cleavage of these proteins in response to chemotherapeutic agents . The specificity of this pathway is demonstrated by the fact that YIPF2 affects TNFRSF10B but not TNFRSF10A levels .

YIPF2 expression might also be linked to endoplasmic reticulum (ER) stress responses. Research suggests that chemotherapeutic agents can induce ER stress in tumor cells, and YIPF2 expression is upregulated along with ER stress markers like XBP1S following treatment with ER stress-inducing agents . This indicates a potential connection between YIPF2, ER stress, and apoptotic pathways.

For researchers investigating these pathways, methodologies should include western blotting for apoptotic markers, flow cytometry for detecting surface death receptors, and real-time monitoring of caspase activation in live cells using fluorescent reporters.

What are the implications of YIPF2 in neurological disorders like Charcot-Marie-Tooth Disease?

YIPF2 has been associated with Charcot-Marie-Tooth Disease, Axonal, Type 2Z (CMT2Z) . This association suggests that YIPF2 may play a role in maintaining neuronal health and function, particularly in peripheral nerves affected by CMT2Z. Given YIPF2's involvement in vesicular transport and protein trafficking , disruption of these processes might contribute to the pathogenesis of CMT2Z by affecting axonal transport mechanisms that are critical for the maintenance of long peripheral nerves.

For researchers investigating the neurological implications of YIPF2, methodological approaches should include:

  • Analysis of YIPF2 expression patterns in neuronal tissues, particularly peripheral nerves

  • Generation and characterization of neuron-specific YIPF2 knockout or transgenic mouse models

  • Investigation of YIPF2 mutations or variants in CMT2Z patient cohorts

  • Functional studies in neuronal cell cultures to assess how YIPF2 manipulation affects axonal transport, neurite outgrowth, and neuronal survival

  • Electron microscopy to examine ultrastructural changes in Golgi morphology and vesicular transport in neurons with altered YIPF2 expression

These approaches can provide insights into the specific mechanisms by which YIPF2 dysfunction contributes to neurological disorders and may reveal potential therapeutic targets for conditions like CMT2Z.

How do YIPF2 interactions with TNFRSF10B influence cell fate decisions?

YIPF2 directly influences cell fate decisions through its interaction with TNFRSF10B (also known as Death Receptor 5 or DR5), a key mediator of the extrinsic apoptotic pathway . Co-immunoprecipitation studies have confirmed that YIPF2 physically interacts with TNFRSF10B . This interaction has significant functional consequences for TNFRSF10B trafficking and surface expression. Specifically, YIPF2 enhances TNFRSF10B recycling to the plasma membrane, leading to increased levels of this death receptor on the cell surface .

The mechanism involves YIPF2 inhibiting the interaction between TNFRSF10B and RAB8, which normally mediates the removal of TNFRSF10B from the plasma membrane to the cytoplasm . By interfering with this interaction, YIPF2 maintains higher levels of TNFRSF10B on the cell surface, making cells more sensitive to death ligands that bind TNFRSF10B and trigger apoptosis.

This YIPF2-TNFRSF10B axis has significant implications for cell fate decisions, particularly in the context of cancer therapy. Higher expression of both YIPF2 and TNFRSF10B correlates with better survival outcomes in chemotherapy-treated cancer patients . This suggests that the YIPF2-mediated increase in surface TNFRSF10B enhances the efficacy of chemotherapeutic agents that induce apoptosis through the extrinsic pathway.

For researchers investigating these interactions, methodological approaches should combine molecular techniques (co-IP, surface biotinylation) with functional assays (apoptosis measurements, death ligand sensitivity) to fully characterize how YIPF2-TNFRSF10B interactions influence cellular responses to therapeutic agents or physiological death signals.

What are the regulatory mechanisms controlling YIPF2 expression and activity?

The regulation of YIPF2 expression appears to be linked to cellular stress responses, particularly endoplasmic reticulum (ER) stress. Research indicates that chemotherapeutic agents like pemetrexed (PEM) can induce ER stress in tumor cells, leading to increased expression of YIPF2 . This upregulation may be mediated through the ER stress response transcription factor XBP1S, which has been suggested to bind to the promoter region of the YIPF2 gene .

At the transcriptional level, the expression patterns of YIPF2 vary across different tissues and disease states. For instance, YIPF2 mRNA levels are significantly lower in lung adenocarcinoma tissues compared to normal tissues . This differential expression pattern suggests tissue-specific and disease-related regulatory mechanisms controlling YIPF2 transcription.

Post-translationally, YIPF2 function may be regulated through its interactions with various proteins, particularly RAB GTPases . These interactions could influence YIPF2's subcellular localization, stability, or functional activity in different cellular contexts.

For researchers investigating YIPF2 regulation, methodological approaches should include:

  • Promoter analysis using reporter assays to identify key regulatory elements in the YIPF2 gene

  • ChIP-seq to identify transcription factors binding to the YIPF2 promoter under different conditions

  • Analysis of post-translational modifications of YIPF2 using mass spectrometry

  • Investigation of YIPF2 protein turnover and stability under various cellular stresses

  • Examination of YIPF2 interactome changes in response to different stimuli or in disease states

These approaches can provide insights into how YIPF2 expression and activity are dynamically regulated in different physiological and pathological contexts.

How do YIPF family members (YIPF1, YIPF2, YIPF6) functionally interact or compensate for each other?

YIPF1, YIPF2, and YIPF6 are related members of the YIP family that share similar subcellular localization patterns, primarily in the medial-/trans-Golgi network . YIPF1 and YIPF2 are homologs of the yeast protein Yif1p, while YIPF6 is a homolog of Yip1p . This evolutionary relationship suggests potential functional overlap or cooperation between these family members.

YIPF1 has been identified as an important paralog of YIPF2 , indicating possible functional redundancy between these two proteins. In experimental systems, this might manifest as compensatory upregulation of one family member when another is knocked down, potentially masking phenotypes in single knockout models.

For researchers investigating the functional relationships between YIPF family members, methodological approaches should include:

  • Simultaneous knockdown or knockout of multiple YIPF family members to reveal compensatory mechanisms

  • Co-immunoprecipitation studies to determine whether YIPF family members physically interact with each other

  • Comparative analysis of binding partners for different YIPF proteins to identify shared versus unique interaction networks

  • Rescue experiments testing whether one YIPF family member can compensate for the loss of another

  • Quantitative analysis of expression correlations between YIPF family members across different tissues and disease states

These approaches can provide insights into the functional relationships between YIPF family members and their collective roles in cellular processes. Understanding these relationships is particularly important when developing therapeutic strategies targeting YIPF proteins, as compensatory mechanisms might affect treatment efficacy.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.