Recombinant Mouse Protein YIPF4 (Yipf4)

Shipped with Ice Packs
In Stock

Description

Role in Golgi Structure Maintenance

YIPF4 forms a stable complex with YIPF3, and their interaction is essential for Golgi integrity. Knockdown of either protein induces Golgi fragmentation .

Golgiphagy Regulation

YIPF4 and YIPF3 act as a receptor complex for selective autophagy of the Golgi apparatus (Golgiphagy):

  • Mechanism: The YIPF3–YIPF4 complex interacts with ATG8 family proteins (e.g., LC3, GABARAPL1/2) via a conserved LC3-interacting region (LIR) motif in YIPF3 .

  • Phosphorylation dependency: Putative phosphorylation sites upstream of the LIR motif enhance ATG8 binding, analogous to the ER-phagy receptor TEX264 .

Autophagic Flux

During nutrient stress or starvation:

  • YIPF4-positive Golgi fragments colocalize with LC3 and are delivered to lysosomes .

  • Degradation of YIPF3/YIPF4 is autophagy-dependent, as shown by accumulation in Atg5-deficient tissues .

Key Experimental Data

ParameterObservationSource
Localizationcis-Golgi, colocalizes with GM130 and TMEM165
Autophagy interactionBinds ATG8 proteins via YIPF3 LIR motif
KO phenotypeReduced Golgiphagy flux in YIPF3/YIPF4-KO cells
Overexpression effectEnhances Golgi fragmentation and autophagic flux

Functional Redundancy

  • YIPF4 stabilizes YIPF3; loss of YIPF4 leads to YIPF3 degradation .

  • Neither protein is required for bulk autophagy or ER-phagy, indicating pathway specificity .

Applications in Research

Recombinant YIPF4 is utilized to study:

  • Golgi dynamics: Live-cell imaging using EGFP/YFP-tagged constructs .

  • Autophagy assays: Quantification of Golgiphagy via mRFP–EGFP–Golgi reporters .

  • Protein interaction mapping: Proximity biotinylation (APEX2–YIPF4) identifies interactomes .

Implications and Future Directions

  • Disease relevance: YIPF4 dysregulation may contribute to Golgi-associated disorders, though direct links remain unexplored .

  • Therapeutic potential: Targeting YIPF3/YIPF4 could modulate Golgi turnover in neurodegenerative diseases or cancer .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific requirements for the format, please indicate them when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please communicate with us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure all contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Yipf4; Protein YIPF4; YIP1 family member 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-246
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Yipf4
Target Protein Sequence
MQPPGPPPAYAPANGDFTFVSSADAEDLSGSIAAPDVKLNLGVSGDFIKESTATTFLRQR GYGWLLEVEDEDPEDNKPLLEELDIDLKDIYYKIRCVLMPMPSLGFNRQVVRDNPDFWGP LAVVLFFSMISLYGQFRVVSWIITIWIFGSLTIFLLARVLGGEVAYGQVLGVIGYSLLPL IVIAPILLVVGSFEMVSTLIKLFGVFWAAYSAASLLVGEEFKTKKPLLIYPIFLLYIYFL SLYTGV
Uniprot No.

Target Background

Function
YIPF4 plays a crucial role in maintaining the structure of the Golgi apparatus.
Database Links
Protein Families
YIP1 family
Subcellular Location
Golgi apparatus, cis-Golgi network membrane; Multi-pass membrane protein.

Q&A

What is YIPF4 and where is it localized in mammalian cells?

YIPF4 is a cis-Golgi-localized transmembrane protein that contains five transmembrane segments. The protein has its N-terminal region exposed to the cytosol and C-terminal region exposed to the Golgi lumen . YIPF4 plays a crucial role in maintaining Golgi structure and function. It primarily localizes to juxtanuclear ribbon-like Golgi structures under normal conditions, showing colocalization with other Golgi markers including GM130 (cis-Golgi), MAN2A1 (medial-Golgi), and TMEM165 (trans-Golgi) . Under cellular stress conditions such as starvation, YIPF4-positive structures become punctate rather than ribbon-like, indicating fragmentation of the Golgi apparatus .

What is the relationship between YIPF3 and YIPF4?

YIPF3 and YIPF4 form a stable complex essential for their function in Golgi homeostasis. AlphaFold-Multimer predictions indicate that these proteins make intimate contacts with each other through their transmembrane segments . The complex formation is hierarchical - YIPF4 is required for YIPF3's stability, suggesting that YIPF3 may be degraded in the absence of YIPF4 . Experimental evidence shows that EGFP-tagged YIPF4 colocalizes with endogenous YIPF3, confirming their association in cellular contexts . Both proteins contain additional helices and unfolded regions at their N-termini, which are important for their functional interactions with autophagy machinery .

How does YIPF4 contribute to cellular homeostasis?

YIPF4, in complex with YIPF3, regulates selective autophagy of the Golgi apparatus (Golgiphagy). This process is critical for maintaining Golgi quality and abundance in response to cellular stresses such as nutrient deprivation . Cells lacking YIPF3 or YIPF4 show selective defects in the elimination of specific Golgi membrane proteins during nutrient stress, highlighting their role in proteome remodeling . Additionally, YIPF4 participates in Golgi remodeling during programmed conversion of stem cells to the neuronal lineage in vitro, suggesting a broader role in cellular differentiation processes .

What reporter systems can be used to study YIPF4 and Golgiphagy?

Two key reporter systems have been developed to study YIPF4-mediated Golgiphagy:

  • mRFP-EGFP-Golgi Reporter: This tandem fluorescent tag system exploits pH sensitivity differences between mRFP and EGFP. Before fusion with lysosomes, tagged proteins show both mRFP and EGFP signals. After fusion with acidic lysosomes, only mRFP signals persist (mRFP+/EGFP-), allowing visualization of lysosomal delivery of Golgi fragments .

  • Halo-mGFP-Golgi Reporter: This system enables quantitative measurement of Golgiphagy flux through SDS-PAGE analysis. When treated with tetramethylrhodamine (TMR)-conjugated Halo ligands, the generation of free Halo tag (33 kDa) through cleavage of Halo-mGFP-Golgi increases upon starvation in wild-type cells but is abolished in autophagy-deficient cells or by lysosomal inhibition .

These systems provide complementary approaches for monitoring YIPF4-mediated Golgiphagy events through both imaging and biochemical analyses.

How can the subcellular localization of YIPF4 be accurately determined?

Determining YIPF4 subcellular localization requires co-localization studies with established Golgi markers. Researchers should use:

  • Compartment-specific markers: GM130 for cis-Golgi, MAN2A1 for medial-Golgi, TMEM165 or GRASP55 for trans-Golgi .

  • Fluorescence microscopy: Confocal microscopy with fixed or live cells expressing fluorescently tagged YIPF4 (e.g., EGFP-YIPF4) alongside markers for different Golgi compartments .

  • Stress condition analysis: Compare localization under normal conditions (typically ribbon-like structures) versus stress conditions such as starvation with Bafilomycin A1 (punctate structures) .

Under starvation conditions with lysosomal inhibition (Bafilomycin A1), YIPF4-positive puncta show significant colocalization with Golgi markers (GM130: 41.2 ± 2.7%; MAN2A1-mCherry: 63.3 ± 6.8%; TMEM165: 59.0 ± 9.0%) .

What methods can verify YIPF4's degradation through autophagy?

To verify that YIPF4 undergoes autophagy-dependent degradation, researchers can employ several complementary approaches:

  • Flux assays: Monitor YIPF4 turnover in the presence and absence of lysosomal inhibitors like Bafilomycin A1 .

  • Genetic approaches: Compare YIPF4 degradation between wild-type cells and autophagy-deficient cells (e.g., FIP200-knockout cells) .

  • Western blotting: Use Halo-mGFP-tagged YIPF4 constructs to detect the appearance of free Halo tag (33 kDa) upon starvation, which is suppressed by autophagy inhibition or deletion of autophagy components .

  • LC3 colocalization: Demonstrate that YIPF4-positive puncta colocalize with LC3, indicating their engulfment by autophagosomes .

Studies have shown that starvation-induced processing of Halo-mGFP-YIPF4 is suppressed by FIP200 deletion, confirming that YIPF4 degradation occurs through autophagy .

How does the YIPF3-YIPF4 complex function as a Golgiphagy receptor?

The YIPF3-YIPF4 complex functions as a Golgiphagy receptor through several key mechanisms:

  • LC3/GABARAP binding: YIPF3 contains a core LC3-interacting region (LIR) motif in its cytosolic N-terminal domain that interacts with ATG8 family proteins . This LIR follows the consensus sequence W/F/Y-X-X-L/V/I, where conserved positions X₀ and X₃ are aromatic and hydrophobic residues, respectively .

  • Phosphorylation-dependent regulation: Putative phosphorylation sites upstream of the LIR in YIPF3 are required for efficient interaction with ATG8 family proteins . Interestingly, the sequence of these phosphorylation sites matches that of TEX264 (a major ER-phagy receptor), suggesting analogous regulatory mechanisms across different selective autophagy pathways .

  • Complex stability: YIPF4 is essential for Golgiphagy at least partially by stabilizing the YIPF3-YIPF4 complex . The complex forms through intimate contacts between their transmembrane segments .

  • Signal-dependent activation: Under nutrient stress, the complex facilitates selective degradation of Golgi membrane proteins, with knockout studies confirming this functional role .

What is the evidence for YIPF4's selective interaction with specific ATG8 family proteins?

YIPF4 shows selective interactions with specific members of the ATG8 family proteins:

  • Proximity biotinylation data: Proteomics analysis revealed that YIPF4 exhibits strong LDS (LIR docking site)-dependent enrichment with GABARAPL2 and, to a lesser extent, with LC3B .

  • Interaction specificity: While YIPF3 was not prominently detected by proximity biotinylation, previous studies reported LDS-dependent interaction between overexpressed LC3B and both YIPF3 and YIPF4 under basal conditions .

  • Abundance profiles: YIPF3's abundance profile in global proteomics experiments resembles those of other established autophagy receptors, supporting its role as a bona fide receptor despite lower detection in proximity biotinylation assays .

This differential binding pattern to ATG8 family members suggests specialized roles in selective autophagy pathways and potential functional divergence among different ATG8 proteins.

How does nutrient stress modulate YIPF4-mediated Golgiphagy?

Nutrient stress significantly impacts YIPF4-mediated Golgiphagy through several mechanisms:

  • Morphological changes: Under starvation conditions, YIPF4-positive structures transition from ribbon-like Golgi structures to punctate structures that colocalize with LC3, indicating fragmentation and autophagosomal targeting .

  • Enhanced degradation: Starvation increases the processing of Halo-mGFP-YIPF4, generating free Halo tag in an autophagy-dependent manner .

  • Selective cargo prioritization: During nutrient stress, cells prioritize degradation of specific membrane proteins through autophagy, with YIPF3 and YIPF4 playing essential roles in this selective process .

  • Proteome remodeling: Cells utilize YIPF3 and YIPF4 to selectively eliminate a specific cohort of Golgi membrane proteins during nutrient stress, contributing to broader proteome remodeling strategies .

These findings collectively demonstrate that nutrient stress activates YIPF4-mediated Golgiphagy as part of an adaptive cellular response to metabolic challenges.

What controls are essential when designing experiments to study YIPF4 function?

When studying YIPF4 function, researchers should include several critical controls:

  • Genetic controls:

    • Wild-type cells vs. autophagy-deficient cells (e.g., FIP200-KO, ATG5-KO)

    • YIPF3 and YIPF4 single and double knockouts to distinguish individual vs. complex functions

  • Pharmacological controls:

    • Bafilomycin A1 treatment to inhibit lysosomal degradation

    • Starvation conditions (e.g., EBSS medium) vs. nutrient-rich conditions

  • Reporter controls:

    • LIR mutant versions of YIPF3 to confirm ATG8 binding dependence

    • Non-Golgi localized transmembrane proteins to confirm specificity of Golgiphagy

  • Colocalization controls:

    • Multiple Golgi markers (GM130, MAN2A1, TMEM165, GRASP55) to confirm Golgi localization

    • LC3 staining to confirm autophagosomal targeting

Quantitative analysis should include statistical testing and appropriate replicates to ensure reproducibility of findings.

How can contradictory results in YIPF4 research be reconciled?

When faced with contradictory results in YIPF4 research, consider the following approaches:

  • Cell type differences: Compare results across different cell lines as YIPF4 function may vary between cell types. Studies have utilized HeLa cells and mouse brain tissues, which may exhibit different YIPF4 dependencies .

  • Experimental conditions: Variations in starvation protocols, duration of treatment, and culture conditions may affect YIPF4-mediated processes. Standardize conditions when comparing results across studies .

  • Compensatory mechanisms: Consider potential redundancy with other Golgi proteins. Long-term YIPF4 depletion might activate compensatory pathways that mask acute phenotypes .

  • Technical approach differences: Different methods (imaging vs. biochemical) may yield apparently contradictory results. Integrate data from multiple methodologies including:

    • mRFP-EGFP-Golgi reporter imaging

    • Halo-mGFP-Golgi processing assays

    • Proteomics analysis

  • Protein expression levels: Overexpression artifacts versus endogenous levels can yield different results. Validate with endogenous protein studies where possible .

What are the key methodological considerations for producing recombinant mouse YIPF4?

When producing recombinant mouse YIPF4 for research applications, consider these methodological aspects:

  • Expression system selection:

    • Mammalian expression systems may preserve post-translational modifications

    • Yeast systems (like Pichia pastoris) can provide natural folding advantages over bacterial systems

    • E. coli systems may be suitable for cytosolic domains but challenging for full-length transmembrane proteins

  • Purification strategy:

    • Consider ion-exchange chromatography for initial purification

    • For transmembrane proteins like YIPF4, detergent selection is critical for maintaining structure and function

    • Affinity tags (His, GST) should be positioned to avoid interference with functional domains

  • Quality control assessments:

    • SDS-PAGE to confirm purity (aim for >95%)

    • Western blotting to verify identity

    • Functional assays to confirm activity, such as binding to YIPF3 or ATG8 family proteins

  • Storage and reconstitution:

    • Lyophilization with appropriate cryoprotectants

    • Reconstitution in sterile phosphate-buffered saline with carrier proteins if needed

    • Aliquoting to avoid freeze-thaw cycles

  • Functional domain considerations:

    • The N-terminal cytosolic domain containing the LIR motif may be expressed separately for interaction studies

    • For full-length protein, appropriate membrane mimetics (nanodiscs, liposomes) may be required to maintain structure

What are the unexplored aspects of YIPF4 biology requiring further investigation?

Several critical aspects of YIPF4 biology remain to be fully elucidated:

  • Regulatory mechanisms: How is YIPF4-mediated Golgiphagy regulated by cellular signaling pathways beyond nutrient stress? Are there specific kinases that phosphorylate the LIR motif of YIPF3 to activate the YIPF3-YIPF4 complex?

  • Cargo selectivity: What determines which Golgi proteins are selected for degradation during YIPF4-mediated Golgiphagy? Are there specific recognition mechanisms or structural features involved?

  • Developmental roles: Given YIPF4's involvement in neuronal differentiation, what are its functions in other developmental contexts and differentiation processes?

  • Disease relevance: Are there connections between YIPF4 dysfunction and human diseases, particularly neurodevelopmental or neurodegenerative disorders?

  • Evolutionary conservation: How conserved is the YIPF3-YIPF4 complex across species, and does its function vary in different organisms?

What emerging technologies might advance YIPF4 research?

Emerging technologies that could significantly advance YIPF4 research include:

  • Cryo-electron microscopy: Determining the high-resolution structure of the YIPF3-YIPF4 complex would provide critical insights into its mechanism of action and interaction with ATG8 family proteins .

  • Advanced live-cell imaging: Techniques such as super-resolution microscopy and lattice light-sheet microscopy could reveal dynamic aspects of YIPF4-mediated Golgiphagy in real-time .

  • Proximity labeling proteomics: Expanded application of BioID or APEX2 technologies to identify the complete interactome of YIPF4 under different cellular conditions .

  • Single-cell analysis: Investigating cell-to-cell variability in YIPF4 expression and function, particularly during developmental processes.

  • CRISPR-based screening: Genome-wide screens to identify additional factors that regulate or cooperate with YIPF4 in Golgiphagy and other cellular processes .

How might YIPF4 research impact understanding of broader cellular processes?

YIPF4 research has potential to enhance understanding of several fundamental cellular processes:

  • Organelle quality control: Insights from YIPF4-mediated Golgiphagy may reveal general principles of organelle turnover and quality control applicable to other cellular compartments .

  • Cellular adaptation to stress: Understanding how YIPF4 contributes to proteome remodeling during nutrient stress may illuminate broader cellular adaptation strategies .

  • Developmental biology: YIPF4's role in neuronal differentiation suggests potential involvement in cellular reprogramming and fate determination mechanisms .

  • Neurodegenerative diseases: Given the importance of autophagy in neurodegenerative disorders, YIPF4's function in neuronal contexts may have relevance to disease mechanisms.

  • Cancer biology: As autophagy plays complex roles in cancer progression and resistance to therapy, understanding YIPF4-mediated selective autophagy may provide insights into cancer cell adaptation mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.