Recombinant Mouse Protein YIPF5 (Yipf5)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please specify it in your order; we will prioritize its incorporation.
Synonyms
Yipf5; Yip1a; Protein YIPF5; YIP1 family member 5; YPT-interacting protein 1 A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-257
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Yipf5
Target Protein Sequence
MSGFDNLNSGFYQTSYSIDEQSQQSYDYGGSGGPYSKQYAGCDYSQQGRFVPPDMMQPQQ TYTGQIYQPTQAYPPTTPQPFYGDSFEEEPPLLEELGINFDHIWQKTLTVLHPLRAADGS IMNETDLAGPVVFCLAFGATLLLAGKIQFGYVYGISAIGCLGMFCLLNLMSMTGVSFGCV ASVLGYCLLPMILLSSFAVVFSLQGMVGILLTATIIGWCSFSASKIFISALAMDGQQLLV AYPCALLYGVFALISVF
Uniprot No.

Target Background

Function
Plays a role in endoplasmic reticulum-Golgi transport.
Database Links
Protein Families
YIP1 family
Subcellular Location
Golgi apparatus, cis-Golgi network membrane; Multi-pass membrane protein. Cytoplasmic vesicle, COPII-coated vesicle. Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Ubiquitously expressed.

Q&A

What is YIPF5 and where is it primarily localized in cells?

YIPF5 is a multi-spanning membrane protein that belongs to the Yip1 domain family. It primarily localizes to the ER-Golgi intermediate compartment (ERGIC) and plays crucial roles in transport between the endoplasmic reticulum (ER) and Golgi apparatus . The protein is also known by several aliases, including YIP1 family member 5, YPT-interacting protein 1A, smooth muscle cell-associated protein 5 (SMAP-5), and golgi membrane protein SB140 . In mouse cells, YIPF5 demonstrates high sequence homology with human YIPF5, with approximately 91% sequence identity in the antigen region .

How conserved is YIPF5 across different species?

YIPF5 is highly conserved across mammalian species, indicating its evolutionary importance in essential cellular functions. According to immunogen sequence analysis, mouse YIPF5 shows 91% sequence identity with human YIPF5, while rat YIPF5 demonstrates 89% sequence identity with the human ortholog . This high degree of conservation suggests that findings from mouse models are likely translatable to human systems, making mouse YIPF5 a valuable research tool for understanding the protein's function in human biology and disease.

What are the key protein domains and structural features of YIPF5?

YIPF5 is characterized as a five-pass transmembrane protein that contains specific domains enabling its function in vesicular transport. While the complete structural details are still being elucidated, the protein contains sequences that facilitate its interaction with components of the vesicular transport machinery, particularly COPII components . The immunogen sequence used for antibody development (SGFENLNTDFY QTSYSIDDQS QQSYDYGGSG GPYSKQYAGY DYSQQGRFVP PD) represents a region that is highly antigenic and useful for detection in experimental systems . Researchers studying YIPF5 structure should focus on transmembrane domains and regions that mediate protein-protein interactions with trafficking machinery components.

What specific role does YIPF5 play in ER-Golgi transport?

YIPF5 plays a critical role in regulating COPI-independent retrograde transport from the Golgi to the ER. Research demonstrates that knockdown of YIPF5 delays the transport of Shiga toxin from the Golgi to the ER but does not affect anterograde transport of VSVGts045 . Mechanistically, YIPF5 appears to facilitate the recruitment of Rab6 to membranes, as YIPF5 knockdown results in Rab6 dissociation from membranes . For researchers investigating vesicular transport, it's important to note that the N-terminal domain of YIPF5 specifically inhibits COPI-independent retrograde transport of GFP-tagged galactosyltransferase (GT-GFP) but does not affect COPI-dependent retrograde transport of p58/ERGIC53 .

How can researchers effectively study YIPF5-mediated vesicular transport in mouse models?

To study YIPF5-mediated vesicular transport in mouse models, researchers should employ a combination of approaches:

  • RNA interference techniques: Both short-hairpin RNA (shRNA) and small-interfering RNA (siRNA) have been effectively used to knock down YIPF5 expression. For siRNA experiments, sequences targeting mouse Yipf5 have been successfully employed with 25-50 nM concentrations .

  • Transport assays: Monitoring cargo movement between organelles using fluorescently-tagged markers such as GT-GFP for COPI-independent transport or p58/ERGIC53 for COPI-dependent transport .

  • Subcellular localization analysis: Co-localization studies with organelle markers like GM130 for cis-Golgi (but not TGN38 for trans-Golgi) can help determine precise localization and trafficking effects .

  • Biochemical interaction studies: Co-immunoprecipitation experiments to identify YIPF5 binding partners within the transport machinery.

When interpreting results, researchers should be cautious about distinguishing direct effects on transport from indirect consequences of altered organelle morphology.

What role does YIPF5 play in innate immune responses to DNA viruses?

YIPF5 has been identified as a positive regulator of STING trafficking, which is essential for innate immune responses to DNA viruses. Research demonstrates that YIPF5 is required for DNA virus- or intracellular DNA-triggered production of type I interferons . Mechanistically, YIPF5 interacts with both STING and components of COPII, facilitating STING recruitment to COPII-coated vesicles in the presence of cytoplasmic dsDNA . This recruitment is crucial for STING trafficking from the ER to the Golgi, which ultimately leads to activation of downstream signaling and induction of type I interferons and proinflammatory cytokines.

How does YIPF5 depletion affect antiviral immune responses in experimental systems?

Knockdown of YIPF5 significantly impairs antiviral immune responses in multiple experimental systems. In both human THP-1 cells and mouse L929 cells, YIPF5 depletion markedly reduces the induction of key antiviral genes including IFNB1, IFIT1, and IL6 in response to HSV-1 infection or transfected dsDNA . This effect is specific to DNA sensing pathways, as YIPF5 knockdown does not affect SeV-induced IFNB1 transcription . At the biochemical level, YIPF5 depletion inhibits:

  • TBK1 phosphorylation and IRF3 dimerization in response to cytoplasmic dsDNA

  • NF-κB activation through inhibition of p65 phosphorylation

  • STING translocation to perinuclear puncta upon dsDNA stimulation

  • STING interaction with downstream signaling components TBK1 and IRF3

These findings have been confirmed in primary bone marrow-derived macrophages (BMDMs) and mouse embryonic fibroblasts (MEFs), indicating the physiological relevance of YIPF5 in antiviral immunity .

What is the relationship between YIPF5 and STING in innate immune signaling?

YIPF5 serves as a critical facilitator of STING trafficking in response to DNA virus infection or cytosolic DNA detection. The relationship between these proteins is characterized by:

  • Physical interaction: YIPF5 physically interacts with STING as demonstrated by co-immunoprecipitation experiments .

  • Trafficking regulation: YIPF5 facilitates STING recruitment to COPII-coated vesicles, which is essential for STING translocation from the ER to the Golgi .

  • Signaling enhancement: Overexpression of YIPF5 enhances STING interaction with downstream signaling components TBK1 and IRF3, while YIPF5 knockdown impairs these interactions .

  • Functional specificity: YIPF5 is also required for constitutive activation of STING-SAVI mutants, suggesting its involvement in pathological STING activation scenarios .

What are the most effective antibodies and detection methods for mouse YIPF5?

For effective detection of mouse YIPF5 in experimental systems, researchers have several validated options:

Antibody TypeApplicationsSpecies ReactivityRecommended DilutionsCatalog Information
Rabbit PolyclonalWestern BlotMouse, Rat, Human1:500-1:2000Proteintech 12931-1-AP
Polyclonal AntibodyWestern Blot, IHCMouse, Human1:100-1:1000PA5-67301

When designing detection experiments, researchers should consider:

  • Antibody validation: Confirm specificity through knockdown controls or recombinant protein detection.

  • Application-specific optimization: Dilution ratios may need adjustment based on specific applications and sample types.

  • Epitope accessibility: The immunogen sequence (SGFENLNTDFY QTSYSIDDQS QQSYDYGGSG GPYSKQYAGY DYSQQGRFVP PD) should be considered when interpreting results, particularly in fixed samples where epitope masking may occur .

What are the most effective gene silencing approaches for YIPF5 functional studies?

Several gene silencing approaches have been successfully employed for YIPF5 functional studies:

  • siRNA-mediated knockdown:

    • Effective siRNA sequences include: 5′-TGGCAAGTGTCCTTGGATA-3′ for human YIPF5

    • Optimal concentration: 25-50 nM siRNA transfected using lipid-based reagents like GenMute

    • Protocol: 6-hour transfection followed by media replacement and 42-hour incubation

  • shRNA-mediated stable knockdown:

    • Effective targeting sequences: 5′-GCGAACACTTACTTACATA-3′

    • Vector systems: pSuper.Retro has been successfully used for stable cell line establishment

  • Experimental considerations:

    • Include appropriate controls (non-targeting sequences)

    • Verify knockdown efficiency by both mRNA and protein detection

    • Monitor potential effects on cell viability and ER/Golgi morphology

    • Consider the degree of knockdown when interpreting phenotypes, as residual YIPF5 may maintain some cellular functions

What experimental systems are most appropriate for studying YIPF5 function in transport versus immunity?

The choice of experimental system depends on the specific aspect of YIPF5 function being investigated:

For transport studies:

  • Cell lines: COS-7, HeLa, or mouse fibroblast cell lines are suitable for studying basic transport mechanisms

  • Cargo proteins: Use model proteins like VSVGts045 for anterograde transport or Shiga toxin for retrograde transport

  • Visualization techniques: Live-cell imaging with fluorescently tagged markers or fixed immunofluorescence microscopy

  • Biochemical approaches: Subcellular fractionation followed by Western blotting to track protein movement between compartments

For immunity studies:

  • Cell lines: THP-1 (human) or L929 (mouse) for initial screening

  • Primary cells: Bone marrow-derived macrophages (BMDMs) and mouse embryonic fibroblasts (MEFs) for physiologically relevant contexts

  • Stimulation methods: HSV-1 infection, transfected dsDNA, or cGAMP treatment to activate STING-dependent pathways

  • Readout assays: qRT-PCR for interferon-stimulated genes (IFNB1, IFIT1, IL6), Western blotting for signaling component activation (TBK1 phosphorylation, IRF3 dimerization)

Researchers should select systems based on their specific research questions, with cell type and experimental readouts matched to the biological process under investigation.

How might YIPF5 be involved in pathological conditions beyond viral immunity?

Given YIPF5's dual roles in vesicular transport and innate immunity, it may be implicated in various pathological conditions:

  • Autoimmune disorders: Since YIPF5 regulates STING trafficking and activation, it might be involved in autoimmune conditions characterized by inappropriate activation of DNA-sensing pathways, such as systemic lupus erythematosus or Aicardi-Goutières syndrome.

  • Neurodegenerative diseases: Dysregulation of ER-Golgi transport is increasingly recognized in neurodegenerative disorders. YIPF5's role in maintaining ER/Golgi structure and function suggests potential involvement in conditions like Alzheimer's or Parkinson's disease.

  • Cancer biology: Altered vesicular trafficking and innate immune evasion are hallmarks of many cancers. YIPF5's functions in both processes make it a candidate for investigation in cancer progression and therapy resistance.

Researchers pursuing these directions should focus on:

  • Analyzing YIPF5 expression patterns in relevant disease tissues

  • Investigating genetic associations between YIPF5 variants and disease susceptibility

  • Developing conditional knockout mouse models to study tissue-specific YIPF5 functions

What are the most promising approaches for studying YIPF5 interactions with the COPII machinery?

To investigate YIPF5 interactions with the COPII machinery, researchers should consider these methodological approaches:

  • Proximity labeling techniques: BioID or APEX2-based approaches to identify proteins in close proximity to YIPF5 in living cells, with a focus on COPII components.

  • Super-resolution microscopy: Techniques like STORM or PALM to visualize co-localization of YIPF5 with COPII components at ER exit sites with nanometer resolution.

  • In vitro reconstitution assays: Purified recombinant YIPF5 and COPII components to study direct interactions and functional effects on vesicle formation.

  • Structure determination: Cryo-EM or X-ray crystallography of YIPF5 alone or in complex with COPII components to understand molecular interaction details.

  • Domain mapping: Systematic analysis using truncation and point mutants to identify specific YIPF5 regions required for COPII interaction and function.

Evidence already suggests YIPF5 co-localizes with SEC31A, a protein enriched at ER exit sites (ERES) , providing a starting point for more detailed interaction studies.

How can contradictory findings on YIPF5's effects on organelle morphology be reconciled in research design?

To reconcile contradictory findings regarding YIPF5's effects on organelle morphology, researchers should implement the following experimental design considerations:

  • Quantitative knockdown assessment: Precisely measure YIPF5 protein levels with quantitative Western blotting to determine the relationship between knockdown efficiency and phenotypic outcomes. Evidence suggests that low residual levels of YIPF5 may be sufficient to maintain normal ER structure .

  • Time-course analyses: Monitor morphological changes over time following YIPF5 depletion to distinguish between immediate direct effects and secondary adaptations.

  • Multiple depletion techniques: Compare phenotypes obtained using different knockdown methods (siRNA, shRNA, CRISPR) to rule out off-target effects.

  • Rescue experiments: Perform complementation with wildtype or mutant YIPF5 to confirm specificity of observed phenotypes.

  • Cell type considerations: Systematically compare effects in different cell types, as cellular context may influence the requirement for YIPF5 in maintaining organelle structure.

  • Combined functional and morphological assessments: Simultaneously measure both organelle morphology and function (e.g., transport rates, protein secretion) to determine whether functional defects can occur independently of structural changes.

This multifaceted approach will help clarify whether discrepancies in the literature reflect biological variables or methodological differences.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.