Recombinant Mouse Proteinase-activated receptor 3 (F2rl2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
F2rl2; Par3; Proteinase-activated receptor 3; PAR-3; Coagulation factor II receptor-like 2; Thrombin receptor-like 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
38-369
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
SFNGGPQNTFEEFPLSDIEGWTGATTTIKAECPEDSISTLHVNNATIGYLRSSLSTQVIP AIYILLFVVGVPANIVTLWKLSLRTKSISLVIFHTNLAIADLLFCVTLPFKIAYHLNGNN WVFGEVTCRITTVVFYGNMYCAILILTCMGINRYLATAHPFTYQKLPKRSFSMLMCGMVW VMVFLYMLPFVILKQEYHLVHSEITTCHDVVDACESPSSFRFYYFVSLAFFGFLIPFVII IFCYTTLIHKLKSKDRIWLGYIKAVLLILVIFTICFAPTNIILVIHHANYYYHNTDSLYF MYLIALCLGSLNSCLDPFLYFVMSKVVDQLNP
Uniprot No.

Target Background

Function

High-affinity G protein-coupled receptor for activated thrombin, stimulating phosphoinositide hydrolysis. It plays a significant role in platelet activation.

Gene References Into Functions
  1. Identification of a hypomethylated region in Iqgap2 (IQ motif-containing GTPase activating protein 2) and F2rl2. PMID: 28179424
  2. Par3(-/-) mice exhibited protection against ferric chloride-induced mesenteric arteriole thrombosis and thromboplastin-induced pulmonary embolism (protease-activated receptor-3 (PAR3)). PMID: 12384423
  3. Crystal structures elucidate the molecular mechanism of cleaved PAR3's cofactor function, bound to exosite I, in thrombin's recognition of PAR4. PMID: 17606903
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure and functional classification of mouse F2rl2?

Mouse F2rl2 (Proteinase-activated receptor 3/PAR3) belongs to the protease-activated receptor family, a subfamily of seven transmembrane G protein-coupled cell surface receptors. The protein contains an extracellular N-terminus with a thrombin cleavage site, seven transmembrane domains, and an intracellular C-terminus involved in signal transduction .

Methodological approach: When investigating F2rl2 structure-function relationships, researchers should employ sequence alignment tools to compare mouse and human orthologs, focusing on the N-terminal domain where proteolytic activation occurs. Expression constructs should include the complete coding sequence (Cys29-Leu705) to maintain functional integrity .

What are the primary signaling mechanisms of F2rl2?

F2rl2 functions as a cofactor in thrombin-mediated cleavage and activation of PAR4 (F2RL3). Upon activation by proteolytic cleavage of its extracellular amino terminus, the newly exposed amino terminus acts as a tethered ligand that activates the receptor . This activation triggers phosphoinositide hydrolysis and subsequent signaling cascades through G-protein coupled pathways .

Methodological considerations: To study F2rl2 signaling, researchers should implement:

  • Calcium mobilization assays to detect intracellular calcium flux

  • Phosphoinositide hydrolysis measurements

  • Co-expression systems with PAR4 to assess cofactor activity

  • G-protein coupling analysis using GTPγS binding assays

How is F2rl2 expression regulated at the molecular level?

Recent research has identified a regulatory axis involving long non-coding RNA NEAT1, which acts as a sponge for miR-582-5p that directly targets F2rl2. In myocardial infarction models, NEAT1 and F2rl2 are highly expressed while miR-582-5p is downregulated .

Methodological approach: For investigating F2rl2 expression regulation:

  • Use the validated primers shown in Table 1 for precise qRT-PCR quantification

  • Employ dual-luciferase reporter assays to verify miRNA binding sites

  • Implement RNA immunoprecipitation to confirm RNA-protein interactions

  • Utilize gain/loss-of-function approaches with shRNA or overexpression vectors

Target geneForward primers, 5′-3′Reverse primers, 5′-3′
mmu-F2RL2GCCAGTCACTGTTTGCCAAAGCCAGCCCTCTATGTCAGAAAGT
hsa-F2RL2GCAAAGCCAACCTTACCCATTGAGGTAGATGGCAGGTATCAGT

What expression systems are optimal for producing recombinant mouse F2rl2?

Recombinant F2rl2 production requires consideration of proper folding and post-translational modifications essential for functionality.

Methodological approach: Based on available data, researchers should consider:

  • Mammalian expression systems (HEK293 cells) for proper folding and glycosylation

  • E. coli systems for producing specific domains (with limitations on functionality)

  • C-terminal tagging strategies (6-His tag) to facilitate purification without disrupting the critical N-terminal region

  • Serum-free formulations for applications requiring carrier-free preparations

When expressing F2rl2, verify protein integrity through Western blot analysis using validated antibodies (e.g., ab40769, Abcam, 1:500 dilution) .

What are the validated protocols for detecting F2rl2 expression in mouse tissues?

For accurate detection and quantification of F2rl2:

Methodological recommendations:

  • RNA extraction using standardized protocols followed by qRT-PCR with validated primers (see Table 1)

  • Protein detection via Western blot using RIPA lysis solution for extraction, followed by BCA protein quantification

  • Load 20 μg protein per lane with GAPDH (ab181602, 1:5000) as loading control

  • For tissue samples, develop standardized collection and processing protocols to minimize degradation

What signaling pathways and protein interaction networks involve F2rl2?

F2rl2 participates in several important signaling networks:

Pathway NamePathway Related Proteins
Neuroactive ligand-receptor interactionAGTR1A, DRD1A, TBXA2R, GRIK4, GABRG1, GCGR, P2RX4, TAAR14E, NPY8BR, HTR6

Methodological approach: For pathway analysis, researchers should:

  • Implement phosphoproteomic analysis to identify phosphorylation cascades

  • Use specific pathway inhibitors to delineate signaling branches

  • Perform co-immunoprecipitation to identify direct protein interaction partners

  • Consider systems biology approaches to map comprehensive signaling networks

How does F2rl2 contribute to myocardial infarction pathophysiology?

F2rl2 plays a significant role in myocardial infarction (MI) pathology. Downregulation of F2rl2 has been shown to ameliorate left ventricular function, reduce infarct area, and decrease cell apoptosis in MI mouse models .

Methodological approach for MI studies:

  • Establish MI mouse models following standardized surgical procedures

  • Assess cardiac function via echocardiography, measuring left ventricular ejection fraction (EF) and fractional shortening (FS)

  • Evaluate infarct size using triphenyltetrazolium chloride and Evans blue staining

  • Analyze tissue pathology with hematoxylin-eosin staining

  • Quantify apoptosis using TUNEL assay

  • For in vitro studies, implement oxygen-glucose deprivation models using human cardiac myocytes

What is the role of the NEAT1/miR-582-5p/F2rl2 regulatory axis in cardiac pathology?

The regulatory network involving NEAT1, miR-582-5p, and F2rl2 has emerged as an important mechanism in myocardial infarction:

Methodological approach:

  • NEAT1 acts as a molecular sponge for miR-582-5p, which targets F2rl2

  • Silencing NEAT1 increases miR-582-5p levels and decreases F2rl2 expression

  • This intervention improves cardiac parameters in MI models

  • Validation requires dual-luciferase reporter assays to confirm direct interactions

  • Gain/loss-of-function studies should manipulate each component of the axis individually

What are the challenges in developing specific modulators for mouse F2rl2?

Developing selective F2rl2 modulators presents several challenges:

Methodological considerations:

  • The high structural similarity between PAR family members requires precise targeting

  • The unique activation mechanism involving proteolytic cleavage complicates traditional drug design approaches

  • Species differences between mouse and human orthologs must be considered for translational research

  • Both orthosteric (binding at the active site) and allosteric (binding at secondary sites) approaches should be explored

  • Validation requires demonstrating specificity against other PAR family members

How should researchers design gain/loss-of-function studies for F2rl2?

For functional studies of F2rl2:

Methodological approach:

  • For knockdown experiments, use validated shRNA approaches as demonstrated in MI studies

  • Verify knockdown efficiency at both mRNA and protein levels

  • Include appropriate controls (e.g., shNC) in all experiments

  • For overexpression studies, consider inducible systems to control expression levels

  • In vivo delivery can be achieved through lentiviral vectors injected directly into target tissues

  • Phenotypic assessment should include both molecular markers and functional outcomes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.