Recombinant Mouse Proteinase-activated receptor 4 (F2rl3)

Shipped with Ice Packs
In Stock

Description

Platelet Activation

PAR4 is indispensable for thrombin-induced platelet aggregation and αIIbβ3 integrin activation. Key findings include:

ParameterWild-Type ResponsePAR4-P322L Mutant ResponseSource
Thrombin EC50 (αIIbβ3)1.0 nM1.8 nM
P-selectin translocation80% max activation40% max activation
Aggregation efficiency100%60% (heterozygous)

The PAR4-P322L mutation (hypo-reactive variant) reduces platelet responsiveness to thrombin but preserves ADP and collagen receptor (GPVI) signaling .

Signaling Pathways

  • G-protein coupling: Activates Gαq/11 and Gα12/13 subunits, triggering phospholipase C (PLC)-mediated calcium mobilization and protein kinase C (PKC) activation .

  • Downstream effects: Regulates coagulation, inflammation, and nociception .

ELISA Kits

The Mouse F2rl3 ELISA Kit (Assay Genie, SKU: MOEB2250) enables quantitative detection:

ParameterSpecification
Detection Range0.312–20 ng/mL
Sensitivity0.17 ng/mL
Intra-assay CV6.8%
Inter-assay CV8.7%
Sample TypesSerum, plasma, cell lysates

Antibodies

  • Clone 5F4 (ThermoFisher): Targets mouse F2rl3 extracellular domain (Epitope: GGTQTPSVYD...LELPDSS) .

  • Applications: Flow cytometry, Western blot, and immunohistochemistry .

PAR4-P322L Knock-in Mice

  • CRISPR/Cas9 design: Introduced P322L mutation (homologous to human P310L) to mimic hypo-reactive PAR4 .

  • Phenotypic outcomes:

    • Prolonged arterial occlusion time (ferric chloride injury model).

    • Mildly increased tail bleeding time in homozygous mutants .

    • No impact on ADP or convulxin responses, confirming PAR4-specific effects .

Clinical Implications

  • Thrombosis therapy: PAR4 inhibitors show potential for reducing clot formation without severe bleeding risks .

  • Disease associations: Dysregulated PAR4 links to stroke, cancer metastasis, and inflammatory disorders .

Recombinant Protein Applications

Recombinant mouse PAR4 is utilized for:

  • Drug discovery: Screening antagonists targeting thrombin-mediated activation.

  • Structural studies: Cryo-EM and mutagenesis to map ligand-binding interfaces .

  • Cell signaling assays: Measuring calcium flux in transfected HEK293 cells .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, kindly specify it in your order remarks, and we will accommodate your request.
Lead Time
Delivery times may vary depending on the purchase method and location. For specific delivery timelines, please consult your local distributors.
Note: All protein shipments are standardly accompanied by blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is discouraged. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which serves as a reference point.
Shelf Life
The shelf life of our products is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms, on the other hand, have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquotting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
F2rl3; Par4; Proteinase-activated receptor 4; PAR-4; Coagulation factor II receptor-like 3; Thrombin receptor-like 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
60-396
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
GYPGKFCANDSDTLELPASSQALLLGWVPTRLVPALYGLVVAVGLPANGLALWVLATRVP RLPSTILLMNLAVADLLLALVLPPRLAYHLRGQRWPFGEAACRVATAALYGHMYGSVLLL AAVSLDRYLALVHPLRARALRGQRLTTGLCLVAWLSAATLALPLTLHRQTFRLAGSDRML CHDALPLTEQTSHWRPAFICLAVLGCFVPLLAMGLCYGATLRALAANGQRYSHALRLTAL VLFSAVASFTPSNVLLVLHYSNPSPEAWGNLYGAYVPSLALSTLNSCVDPFIYYYVSHEF REKVRAMLCRQPEASSSSQASREAGSRGTAICSSTLL
Uniprot No.

Target Background

Function
This receptor functions as a G protein-coupled receptor for activated thrombin or trypsin. It stimulates phosphoinositide hydrolysis and may play a role in platelet activation.
Gene References Into Functions
  1. PAR-4 activation and its binding to TERT are crucial steps in inducing apoptosis of islet beta cells under high-glucose/fatty acid conditions in type 2 diabetes. PMID: 30186877
  2. This research provides novel insights into the internalization of activated PAR4 and its link to proper ERK1/2 and Akt activation. PMID: 27402844
  3. Par4 deficiency offers cardioprotection following acute ischemia reperfusion injury. PMID: 26643815
  4. Stimulation of bladder PAR4 impacts urothelial HMGB1 release. PMID: 27010488
  5. Thrombin cleavage of platelet PAR4 facilitates leukocyte recruitment to sites of vascular injury. PMID: 26204458
  6. PAR4 blockade impedes neutrophil migration in vivo, suggesting a significant role for PAR4 in regulating inflammation. PMID: 25118784
  7. PAR-4 appears to play a previously unrecognized role in diabetic vasculopathy. PMID: 25239438
  8. mPAR4 contributes to antibacterial defense during murine pneumococcal pneumonia. PMID: 23783078
  9. PAR-4 emerges as a potential target for future therapeutic strategies against platelet-mediated liver injury during transplantation. PMID: 24434483
  10. These findings demonstrate that PAR-4 does not play a significant role in pulmonary fibrosis. PMID: 23024330
  11. These data suggest a key role for PAR4 in mediating neutrophil recruitment in a mouse model of pleurisy induced by trypsin or trypsin-like enzymes. PMID: 22517275
  12. Data indicate that PAR-4 activation is endogenously involved as a feedback loop to attenuate inflammatory colonic hyperalgesia to colorectal distension. PMID: 22044612
  13. PARs are involved in modulating joint pain, with PAR-4 exhibiting a pronociceptive effect in this tissue. Therefore, blocking articular PAR-4 could be a valuable approach to control joint inflammation and pain. PMID: 19248120
  14. Arrestin-2 regulates PAR4-dependent signaling pathways but not responses to ADP alone. It contributes to thrombus formation in vivo. PMID: 21106537
  15. This work demonstrates a crucial role for PAR-4 in mediating eosinophil recruitment in an allergic pleurisy model in mice. PMID: 20829647
  16. Data indicate that PAR4 deficiency protects mice from cerebral ischemia/reperfusion (I/R) injury, partly through inhibition of platelet activation and attenuation of microvascular inflammation. PMID: 20087365
  17. This study provides the first evidence that PAR4 is localized in mossy fiber axons. Its altered expression in CA3 neurons after ischemia suggests a possible role for PAR4 in post-ischemic adaptive mechanisms. PMID: 19859967
  18. PAR4 activation mediates the potentially detrimental effects of thrombin on microglia, suggesting a shift in focus from PAR1 as a potential anti-inflammatory target to PAR4. PMID: 12775717
  19. Mice lacking both PAR4 and fibrinogen exsanguinated at birth, similar to prothrombin-deficient mice. PMID: 14504091
  20. Platelets treated with a PAR-4 antagonist, as well as platelets isolated from PAR-4 homozygous null mice, failed to aggregate in response to plasmin. Plasmin induces platelet aggregation primarily through slow cleavage of PAR-4. PMID: 14973136
  21. PAR4 heterozygosity provided some protection against metastasis in a melanoma metastasis model. PMID: 15031212
  22. PAR4 plays a role in thrombin signaling in platelets. PMID: 15304051
  23. Par4 plays a significant role in tumor suppression, particularly in the endometrium and prostate. PMID: 15877079
  24. Thrombin activation of PAR4 can occur with exosite I available to bind cofactor molecules, such as the cleaved form of PAR3. PMID: 17606903
  25. PAR-4 plays a significant role in the Shwartzman reaction. Inhibition of PAR-4 signaling in neutrophils could offer protection in systemic inflammation and disseminated intravascular coagulation. PMID: 17641206
  26. Activation of PAR-4 on platelets is crucial in soluble tissue factor-induced inflammation. PMID: 18412955
  27. Par4 deficiency in the mother, or the absence of maternal platelets, restores normal development in one-third of Thbd-null embryos. PMID: 18490515
  28. PAR4 signaling enhances platelet aggregate stability through mechanisms independent of other thrombin-dependent pathways, such as fibrin formation. PMID: 18983510
  29. These results identify PAR(4) as a previously unknown modulator of visceral nociception. PMID: 19413681
  30. Murine platelets are more sensitive to plasmin than human platelets due to differences in the primary sequence of PAR4. In contrast to thrombin-dependent activation of platelets, mPAR3 inhibits plasmin-induced PAR4 activation. PMID: 19437337
  31. These findings demonstrate that activation of PAR(4) on colonic dorsal root ganglia neurons suppresses their excitability. PMID: 19566587
  32. Mechanism of the anticoagulant activity of thrombin mutant W215A/E217A. PMID: 19586901

Show More

Hide All

Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Highly expressed in the spleen. Slight expression in the heart, lung, skeletal muscle and kidney. No detectable expression in brain, liver or testis. Also detected in platelets.

Q&A

What is Proteinase-activated receptor 4 (F2rl3) and how does it function?

Proteinase-activated receptor 4 (PAR4), also known as F2rl3 or Coagulation Factor II (Thrombin) Receptor-like 3, belongs to the family of Protease-activated Receptors - a unique class of seven transmembrane G protein-coupled receptors activated through proteolytic cleavage. PAR4 is approximately 385 amino acids in length with a molecular weight of 41.1 kDa .

The receptor functions through a distinctive activation mechanism where proteases (primarily thrombin, trypsin, and cathepsin G) cleave the N-terminal extracellular domain, generating a new N-terminus. This newly exposed N-terminus then acts as a tethered ligand that binds to extracellular loop 2 of the receptor, triggering downstream signaling . Mouse PAR4 shares approximately 78% amino acid sequence identity with the human ortholog, making it a valuable model for translational research .

What is the tissue distribution pattern of PAR4 in mice?

PAR4 exhibits wide tissue distribution with varying expression levels across different organs and cell types. The highest expression levels in mice are observed in:

Tissue/Cell TypeRelative ExpressionFunctional Significance
LungsHighInvolved in inflammatory responses
PancreasHighPotential role in enzyme secretion
ThyroidHighFunction not fully elucidated
TestisHighRole in reproductive function under investigation
Small intestineHighRegulates gastrointestinal motility
PlateletsModerateCritical for hemostasis and thrombosis
MegakaryocytesModerateImportant for platelet development
LeukocytesModerateContributes to inflammatory processes

This wide distribution pattern suggests multiple physiological functions beyond hemostasis and thrombosis, including roles in inflammation, pain sensation, and tissue remodeling .

How do researchers detect endogenous PAR4 expression in experimental systems?

Detection of endogenous PAR4 expression in experimental systems has historically been challenging due to limited availability of specific antibodies. Recent advances have produced several validated detection methods:

Monoclonal antibodies targeting the N-terminal extracellular domain of PAR4 (such as 14H6, 5F10, and 2D6) now enable reliable detection of PAR4 expression in various experimental settings . These antibodies can be applied in multiple techniques:

  • Immunoblotting (Western blot): For quantitative analysis of total PAR4 protein levels

  • Immunofluorescence microscopy: For visualization of cellular localization

  • Flow cytometry: For measuring surface expression levels on intact cells

For enhanced sensitivity, researchers can employ RT-PCR or qPCR to detect F2rl3 mRNA expression using validated primer sets specific to mouse PAR4 . The availability of PAR4-knockout (F2RL3^-/-) mice provides essential negative controls to confirm antibody specificity and validate experimental findings .

What strategies exist for selectively activating or inhibiting mouse PAR4 in experimental systems?

Selective activation or inhibition of mouse PAR4 requires sophisticated approaches to ensure specificity given the functional overlap with other PARs. Researchers have several methodological options:

Selective Activation Approaches:

  • Thrombin at controlled concentrations: While thrombin activates both PAR1 and PAR4 in mice, careful titration (typically 0.1-10 nM) combined with PAR1 antagonists can achieve preferential PAR4 activation

  • PAR4-activating peptides (PAR4-APs): Synthetic peptides mimicking the tethered ligand sequence (GYPGKF for mouse PAR4) provide direct receptor activation without proteolysis

  • Cathepsin G: At specific concentrations, preferentially activates PAR4 over other PARs in mouse platelets

Selective Inhibition Strategies:

  • Targeted antibodies: The monoclonal antibody 5F10 has demonstrated ability to partially inhibit PAR4 cleavage by α-thrombin in expression systems

  • Small molecule antagonists: While most PAR4 antagonists were developed for human PAR4, compounds with cross-reactivity to mouse PAR4 can be identified through careful pharmacological characterization

  • Genetic approaches: PAR4-knockout mice (F2RL3^-/-) provide complete absence of receptor function, while conditional knockout systems using Cre-loxP technology enable tissue-specific deletion

When designing experiments with these tools, researchers should include appropriate controls to confirm specificity, such as using PAR1-knockout mice alongside PAR4 activators to eliminate confounding effects of PAR1 activation .

How can researchers effectively study PAR4-specific signaling pathways in mouse models?

Studying PAR4-specific signaling pathways requires careful experimental design to distinguish PAR4-mediated effects from those of other receptors. An effective methodological framework includes:

Isolation of PAR4 Signaling:

  • Use comparative analysis between wild-type and PAR4-knockout (F2RL3^-/-) mice to identify PAR4-dependent responses

  • Apply selective PAR4 agonists alongside specific inhibitors of downstream pathways to map signaling cascades

  • Employ PAR4-selective antibodies that can detect activation-dependent epitope changes

Recommended Signaling Assays:

  • For G protein signaling: Measure intracellular calcium mobilization, inositol phosphate accumulation, and RhoA activation

  • For platelet function: Assess aggregation, secretion, and integrin activation in platelets from wild-type versus PAR4-knockout mice

  • For tissue-specific responses: Employ ex vivo tissue preparations (e.g., vessel rings, lung slices) to measure physiological outputs

PAR4 couples primarily to Gαq and Gα12/13 subunits, activating PLC-IP3-Ca^2+ and PLC-DAG-PKC signaling pathways . These can be monitored using pathway-specific inhibitors and readouts to determine the relative contribution of each signaling branch to observed phenotypes.

What methodological considerations are important when studying PAR4-PAR1 interactions in mouse experimental systems?

The functional interplay between PAR4 and PAR1 presents unique experimental challenges, particularly in mouse models where both receptors contribute to thrombin signaling in platelets. Addressing these interactions requires specialized approaches:

Essential Methodological Considerations:

  • Mouse-specific differences: Unlike human platelets where PAR1 is the primary thrombin receptor, mouse platelets rely more heavily on PAR4, with PAR3 serving as a cofactor rather than signaling directly

  • Receptor co-expression: PAR4 requires PAR3 as a cofactor for optimal thrombin-induced platelet activation in mice, necessitating evaluation of both receptors

  • Hetero-oligomerization effects: PAR4 forms hetero-oligomers with PAR1, which enhances PAR4 cleavage rate by thrombin

Recommended Experimental Approaches:

  • Co-immunoprecipitation studies to assess physical interactions between PAR4 and other receptors

  • FRET/BRET analyses to measure real-time receptor proximity and interactions

  • Comparative signaling studies in cells expressing PAR4 alone versus PAR4+PAR1 or PAR4+PAR3

When designing experiments, researchers should consider the temporal differences in PAR1 versus PAR4 activation, with PAR1 responding rapidly to low thrombin concentrations while PAR4 requires higher thrombin concentrations but produces more sustained signaling .

How do genetic variations in mouse PAR4 inform our understanding of human cardiovascular disease risks?

Genetic variations in PAR4 have emerged as significant contributors to thrombotic risk and treatment response variability, with important translational implications. Mouse models provide valuable insights into these genetic effects:

Key Genetic Variations and Their Functional Consequences:
Studies in human populations have identified polymorphisms in PAR4 at positions 120 (Ala/Thr) and 296 (Phe/Val) that influence receptor function and are distributed according to racial background . The PAR4-120T variant exhibits hyperreactivity to agonists and resistance to PAR4 antagonists, being found predominantly in Black individuals, while PAR4-120A shows lower reactivity and is more common in White individuals .

Mouse models with engineered mutations mimicking these human polymorphisms provide experimental systems to investigate underlying mechanisms of altered PAR4 function. These models reveal how specific amino acid changes affect:

  • Receptor expression levels

  • Efficiency of thrombin-mediated activation

  • Downstream signaling potency

  • Response to pharmacological inhibitors

Translational Implications:
This research has direct relevance to personalized antiplatelet therapy approaches, as PAR4 antagonists may have differential efficacy based on PAR4 genotype . Mouse models carrying human PAR4 variants offer valuable platforms for preclinical testing of novel antiplatelet agents across genetically diverse populations.

What are the methodological approaches for studying PAR4's role in inflammatory processes beyond platelet function?

While PAR4's role in platelet function is well-established, emerging evidence indicates important contributions to inflammatory processes. Investigating these non-hemostatic functions requires specialized methodological approaches:

Experimental Systems for Studying PAR4 in Inflammation:

  • Tissue-specific conditional knockout models to isolate PAR4 function in specific inflammatory cell types

  • Bone marrow chimera experiments to distinguish hematopoietic versus non-hematopoietic PAR4 functions

  • Ex vivo tissue culture systems combined with selective PAR4 agonists/antagonists

Key Readouts for Inflammatory Processes:

  • Leukocyte migration and recruitment to inflammatory sites

  • Cytokine/chemokine production profiles

  • Vascular permeability changes

  • Tissue-specific inflammatory responses

Notable Research Findings:
In rodent models, PAR4 has demonstrated important roles in joint pain and inflammation, suggesting potential applications in arthritis research . Additionally, PAR4 expression is enhanced in high glucose-stimulated vascular smooth muscle cells and upregulated in diabetes, contributing to diabetic vasculopathy . These findings point to PAR4 as a potential therapeutic target in multiple inflammatory conditions beyond thrombosis.

How can recombinant mouse PAR4 proteins be effectively utilized in drug discovery and validation studies?

Recombinant mouse PAR4 proteins represent valuable tools for drug discovery programs targeting PAR-mediated pathways. Their effective utilization requires understanding of specific applications and limitations:

Optimal Applications of Recombinant PAR4 Proteins:

  • High-throughput screening assays for novel PAR4 modulators

  • Structural studies to identify binding sites for therapeutic candidates

  • Generation of PAR4-specific antibodies and validation reagents

  • Protein-protein interaction studies to identify novel binding partners

Recommended Expression Systems:
For functional studies, mammalian expression systems (such as HEK293 cells with tetracycline-inducible expression) provide properly folded and post-translationally modified PAR4 proteins . Full-length PAR4 expression is challenging due to its multiple transmembrane domains; therefore, researchers often employ:

  • N-terminal extracellular domain fragments for antibody generation and binding studies

  • Fusion proteins (such as MBP-PAR4 constructs) for enhanced stability and purification

  • Epitope-tagged versions (Myc-DDK-tagged constructs) for detection and purification applications

Validation Approaches:
When using recombinant PAR4 proteins, researchers should validate proper folding and function through:

  • Ligand binding assays with known PAR4 activators

  • Confirmation of proteolytic cleavage at the expected sites

  • Antibody recognition profiles compared to native PAR4

The development of monoclonal antibodies like 14H6, 5F10, and 2D6 that recognize specific epitopes on PAR4 has significantly enhanced the utility of recombinant PAR4 proteins in validation studies .

What are common challenges in expressing functional recombinant mouse PAR4 and how can they be addressed?

Expression of functional recombinant mouse PAR4 presents several technical challenges due to its nature as a seven-transmembrane G protein-coupled receptor. Researchers frequently encounter these difficulties and should consider the following solutions:

Challenge 1: Low expression levels and protein instability

  • Solution: Optimize codon usage for the expression system, incorporate stabilizing mutations, and use inducible expression systems to minimize toxicity

  • Approach: The pCMV6-Entry vector system with neomycin selection has been validated for mammalian expression of PAR4

Challenge 2: Improper folding and trafficking

  • Solution: Express PAR4 in mammalian cell lines (HEK293, CHO) rather than bacterial systems to ensure proper post-translational modifications and folding

  • Approach: Include chaperone proteins or grow cells at reduced temperatures (30-32°C) to improve folding efficiency

Challenge 3: Difficulties in functional assessment

  • Solution: Design reporter systems linked to known PAR4 signaling pathways (Gαq and Gα12/13)

  • Approach: Calcium mobilization assays using fluorescent indicators provide reliable readouts of PAR4 activation

Challenge 4: Receptor degradation during purification

  • Solution: Use mild detergents (DDM, LMNG) and include protease inhibitors throughout purification

  • Approach: Epitope tags like Myc-DDK can facilitate purification while maintaining receptor function

Researchers should validate recombinant PAR4 expression through multiple techniques including western blotting, flow cytometry, and functional assays to confirm both expression and activity of the recombinant receptor.

How can researchers effectively differentiate between PAR4-specific effects and contributions from other PARs in complex biological systems?

Distinguishing PAR4-specific effects from those mediated by other PARs presents significant challenges in complex biological systems due to overlapping expression patterns and functional redundancy. Effective experimental strategies include:

Genetic Approaches:

  • Utilize PAR4-knockout (F2RL3^-/-) mice alongside single knockouts of other PARs to isolate receptor-specific contributions

  • Implement conditional and inducible knockout systems for temporal and spatial control of PAR4 expression

  • Apply CRISPR/Cas9-mediated editing to introduce receptor-specific mutations that affect activation or signaling

Pharmacological Strategies:

  • Deploy PAR-selective activating peptides at carefully titrated concentrations:

    • PAR1: TFLLR-NH₂

    • PAR2: SLIGRL-NH₂

    • PAR4: GYPGKF-NH₂

  • Use receptor-selective antagonists in combination studies to block specific PAR subtypes

  • Implement antibody-based inhibition with the PAR4-specific antibody 5F10, which partially blocks thrombin-mediated PAR4 activation

Analytical Approaches:

  • Apply multivariate statistical methods to differentiate receptor-specific signals

  • Conduct time-course studies to separate rapid (typically PAR1) from sustained (typically PAR4) responses

  • Use receptor co-expression studies with dominant-negative mutants to dissect specific contributions

What quality control measures are essential when working with commercially available recombinant mouse PAR4 proteins?

When working with commercially available recombinant mouse PAR4 proteins or expression constructs, implementing rigorous quality control measures is essential to ensure experimental reliability:

Pre-experiment Validation:

  • Sequence verification: Confirm the complete coding sequence matches the reference mouse F2rl3 sequence (NM_003950 for the human ortholog)

  • Expression testing: Validate protein expression using western blot with epitope tag antibodies (for tagged constructs) or PAR4-specific antibodies

  • Purity assessment: Analyze by SDS-PAGE and mass spectrometry to confirm size and absence of degradation products

Functional Validation:

  • Proteolytic activation: Verify the recombinant protein can be cleaved by thrombin at the expected site

  • Binding studies: Confirm interaction with known PAR4 binding partners or antibodies

  • Signaling assays: For cell-expressed recombinant PAR4, test functional coupling to downstream pathways (calcium mobilization, ERK phosphorylation)

Stability Monitoring:

  • Implement regular testing schedule for long-term storage conditions

  • Document lot-to-lot variation for commercial preparations

  • Include positive controls with established activity in each experimental series

For expression constructs, such as the pCMV6-Entry vector containing PAR4 (F2RL3), protein expression should be verified by western blot before conducting functional studies . Additionally, researchers should confirm proper localization of expressed PAR4 to the plasma membrane through immunofluorescence or cell surface biotinylation assays.

How are researchers utilizing mouse models to investigate the role of PAR4 in diseases beyond thrombosis?

While PAR4's role in thrombosis and hemostasis is well-established, emerging research has expanded into diverse pathological contexts using sophisticated mouse models:

Cardiovascular Disorders Beyond Thrombosis:
PAR4 inhibition has demonstrated cardioprotective effects against myocardial ischemia/reperfusion injury in mouse models . These studies employ selective PAR4 antagonists administered prior to induced ischemia, revealing mechanisms distinct from antiplatelet effects, including direct actions on cardiomyocytes and vascular cells.

Inflammatory and Pain Conditions:
In rodent models, PAR4 has shown significant involvement in joint pain and inflammation . Researchers utilize:

  • Intra-articular injection models with PAR4 agonists/antagonists

  • Comparative studies in PAR4-knockout versus wild-type mice

  • Behavioral pain assessments coupled with molecular analysis of inflammatory mediators

Metabolic Disorders:
Recent studies have revealed that PAR4 expression is enhanced in high glucose-stimulated human vascular smooth muscle cells and upregulated in diabetes . Mouse models of diabetes (both genetic and induced) combined with PAR4 manipulation are unveiling mechanisms of diabetic vasculopathy, potentially identifying new therapeutic targets.

Cancer Biology:
The observation that PAR4 down-regulation occurs frequently in gastric cancers and associates with aggressive progression has stimulated research using orthotopic tumor models in mice. These studies examine how PAR4 expression levels influence:

  • Tumor growth and metastatic potential

  • Response to chemotherapeutic agents

  • Tumor-promoting inflammation in the microenvironment

What recent methodological advances have improved our ability to study PAR4 activation dynamics in real-time?

Recent technological developments have significantly enhanced capabilities for studying PAR4 activation dynamics in real-time, providing unprecedented insights into receptor function:

Biosensor Technologies:

  • FRET/BRET-based conformational sensors incorporated into PAR4 structure allow detection of receptor activation with millisecond resolution

  • Genetically encoded calcium indicators (GECIs) coupled to PAR4 downstream signaling provide readouts of pathway activation

  • PAR4-specific antibodies (14H6, 5F10) that recognize activation-dependent epitopes enable flow cytometric monitoring of receptor cleavage and activation

Advanced Microscopy Approaches:

  • Super-resolution microscopy techniques (STORM, PALM) reveal PAR4 organization in membrane microdomains

  • Single-molecule tracking methodologies monitor individual receptor mobility changes upon activation

  • Light-sheet microscopy allows visualization of PAR4 activation in thick tissue preparations and organoids

Microfluidic Systems:

  • Custom-designed microfluidic platforms enable precise control of protease delivery to cells expressing PAR4

  • Gradient generators create defined protease concentration profiles for dose-response studies

  • Integration with real-time imaging permits correlation of PAR4 activation with cellular responses

These methodologies have revealed that PAR4 activation dynamics differ significantly from PAR1, with slower but more sustained signaling profiles that contribute to distinct physiological roles . The antibodies 14H6 and 5F10, which are sensitive to PAR4 activation by α-thrombin, provide invaluable tools for monitoring the initial step in PAR4 activation in real-time experimental systems .

How is our understanding of PAR4 pharmacology evolving, and what implications does this have for drug development targeting mouse versus human PAR4?

The pharmacological understanding of PAR4 has evolved substantially, revealing important species differences that impact translational drug development:

Species-Specific Pharmacological Profiles:
Despite 78% amino acid sequence homology between human and mouse PAR4 , significant pharmacological differences exist:

  • Mouse PAR4 typically requires higher thrombin concentrations for activation

  • Species-specific differences in PAR4 antagonist binding sites affect drug potency

  • The interaction between PAR4 and other receptors (particularly PAR3) differs between species

Implications for Drug Development:
These species differences create translational challenges that researchers address through:

  • Development of "humanized" mouse models expressing human PAR4

  • Parallel screening of compounds against both mouse and human PAR4

  • Structural biology approaches to identify conserved binding sites for broad-spectrum antagonists

Emerging Pharmacological Approaches:

  • Biased ligand development: Compounds that selectively activate beneficial PAR4 signaling pathways while minimizing detrimental ones

  • Allosteric modulators: Drugs targeting sites distinct from the orthosteric binding site to modify receptor function

  • Peptide-based inhibitors: Designed against specific PAR4 domains involved in receptor activation or protein-protein interactions

Genetic Variation Considerations:
Recent discoveries of PAR4 polymorphisms (positions 120 and 296) that affect receptor function and drug response necessitate genotype-specific pharmacological characterization . Mouse models carrying these human variants serve as platforms for preclinical evaluation of candidate compounds across genetically diverse populations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.