Recombinant Mouse Psychosine receptor (Gpr65)

Shipped with Ice Packs
In Stock

Description

Molecular Identity and Classification

GPR65, also known as T-cell death-associated gene 8 (TDAG8) or Psychosine receptor, belongs to the G protein-coupled receptor family, specifically the subfamily of proton-sensing receptors. In mice, GPR65 is encoded by the Gpr65 gene (gene ID: 14744) . The protein is characterized as a seven-transmembrane domain receptor that interacts with G proteins to transduce extracellular signals into intracellular responses . Within the broader classification system, GPR65 falls under the lysophospholipid/lysosphingolipid receptor category, sharing functional similarities with other members of the proton-sensing receptor subfamily including GPR4, GPR68, and GPR132 .

GPR65 has gained significant attention due to its specific binding capabilities and its potential involvement in various physiological and pathological processes. The receptor's ability to sense extracellular pH changes makes it particularly relevant in inflammatory microenvironments where acidification frequently occurs. Additionally, its reported interaction with psychosine, a toxic lipid associated with Krabbe disease, highlights its potential significance in understanding and addressing neurological disorders .

Ligand Binding Properties

GPR65 was initially reported to be a specific receptor for psychosine (d-galactosyl-β-1,1′ sphingosine) and several other related glycosphingolipids . Psychosine is a toxic lipid formed by the breakdown of galactosylceramide (cerebroside), which accumulates in Krabbe disease due to a deficiency in galactosylceramidase . The interaction between GPR65 and psychosine has important implications for understanding the pathophysiology of this neurodegenerative disorder.

pH Sensing Mechanism

A particularly significant function of GPR65 is its ability to sense extracellular pH. Research has demonstrated that levels of cyclic adenosine monophosphate (cAMP), a secondary messenger associated with GPCR activation, increase in cells expressing GPR65 when exposed to neutral to acidic extracellular pH conditions (pH 7.0-6.5) . This pH-sensing capability appears to be mediated through the protonation of histidine residues in the receptor structure .

Interestingly, the presence of psychosine affects this pH-sensing function. When psychosine is present, the levels of cAMP increase at a shifted, more acidic pH range, suggesting that psychosine acts as an antagonist of GPR65 when the receptor is stimulated by increasing proton concentrations . This finding has challenged earlier reports that characterized psychosine as an activating ligand for GPR65.

Further research has confirmed the pH-sensing ability of GPR65, demonstrating that cAMP levels increase when the receptor is stimulated by pH values less than 7.2 . This property makes GPR65 particularly relevant in biological environments where pH fluctuations occur, such as inflammatory sites and tumor microenvironments.

Tissue Distribution and Expression

GPR65 exhibits a distinctive tissue distribution pattern that provides insights into its physiological roles. The receptor is primarily expressed in lymphoid tissues, including the spleen, lymph nodes, thymus, and leukocytes . This expression pattern suggests that GPR65 may play important roles in immune function and inflammatory responses.

Recent research has expanded our understanding of GPR65's physiological roles. For instance, studies indicate that GPR65 might be involved in inhibiting osteoclastic bone resorption in mouse models of ovariectomy by sensing the acidic extracellular environment . Additionally, GPR65 has been implicated in the regulation of tumor growth, potentially by supporting cell survival in acidic conditions characteristic of tumor microenvironments .

More recently, GPR65 has been linked to inflammatory pain mechanisms. The receptor is characterized as a proton-sensing G-protein-coupled receptor (PS-GPCR) with potential involvement in coordinating nociception, particularly in the context of fibroblast-like synoviocytes that line synovial joints .

Expression Systems

The production of recombinant mouse GPR65 involves various expression systems, each offering distinct advantages for different research applications. Based on the available commercial products, two primary expression systems are utilized:

  1. E. coli Expression System: This bacterial expression system is employed for the production of certain recombinant mouse GPR65 proteins. For example, Cusabio offers a recombinant mouse psychosine receptor (Gpr65) produced using an in vitro E. coli expression system . Similarly, Creative Biomart offers a full-length recombinant mouse GPR65 protein expressed in E. coli . The bacterial expression system typically provides high protein yields at relatively lower costs, though proper protein folding can be a challenge for complex membrane proteins like GPCRs.

  2. Mammalian Expression System (HEK293): Creative Biomart also offers recombinant mouse GPR65 protein expressed in human embryonic kidney 293 (HEK293) cells . The mammalian expression system provides advantages for the production of mammalian proteins, particularly membrane proteins, as it offers a cellular environment more similar to the protein's native context, potentially improving proper folding and post-translational modifications.

The choice between these expression systems depends on the specific research requirements, including the need for proper protein folding, post-translational modifications, and the intended applications of the recombinant protein.

Protein Tagging Strategies

Various tagging strategies are employed in the production of recombinant mouse GPR65 to facilitate purification, detection, and functional studies. The commercial products available utilize several tagging approaches:

  1. His Tag: Histidine tags (typically consisting of six or more histidine residues) are commonly used for affinity purification using metal chelation chromatography. Creative Biomart offers recombinant mouse GPR65 proteins with His tags .

  2. Fc Tag: The Fc region of immunoglobulin provides advantages for purification using protein A or G, and can enhance protein stability and half-life. Creative Biomart provides recombinant mouse GPR65 with Fc tags .

  3. Avi Tag: This tag allows for site-specific biotinylation, which can be useful for various detection and immobilization applications. Creative Biomart offers recombinant mouse GPR65 with Avi tags in combination with other tags (His-Fc-Avi) .

  4. GST Tag: Glutathione S-transferase tags facilitate purification using glutathione affinity chromatography and can enhance protein solubility. Some variants of recombinant GPR65 proteins are available with GST tags .

The selection of appropriate tags depends on the intended applications, including purification strategies, detection methods, and functional assays.

Quality Control Parameters

The production of recombinant mouse GPR65 involves rigorous quality control to ensure protein integrity and functionality. Several parameters are assessed as part of quality control processes:

  1. Purity: Commercial products typically specify purity levels, often determined by SDS-PAGE analysis. For instance, Creative Biomart specifies a purity of ≥85% for their recombinant mouse GPR65 protein with His (Fc)-Avi tag .

  2. Endotoxin Levels: For applications involving cell culture or in vivo studies, endotoxin contamination is carefully monitored. Creative Biomart reports endotoxin levels of < 1.0 EU per μg of protein for their recombinant mouse GPR65 product .

  3. Stability: Stability assessments provide information about the shelf life and storage requirements of the recombinant proteins. Creative Biomart indicates that their recombinant mouse GPR65 protein remains stable for at least 6 months when stored under proper conditions .

These quality control parameters ensure that researchers receive reliable and consistent recombinant protein products for their studies.

Role in Krabbe Disease Research

One of the most significant applications of recombinant mouse GPR65 is in research related to Krabbe disease, a severe neurodegenerative disorder. GPR65 has been identified as a molecular target for psychosine, a toxic lipid that accumulates in Krabbe disease due to a deficiency in galactosylceramidase . The accumulation of psychosine leads to the death of myelin-synthesizing cells (oligodendrocytes), which is a central feature of Krabbe disease pathology .

Recombinant mouse GPR65 provides a valuable tool for investigating the molecular mechanisms underlying psychosine toxicity and the pathogenesis of Krabbe disease. Researchers can use the recombinant protein to study:

  1. The specific interactions between psychosine and GPR65

  2. The signaling pathways activated by this interaction

  3. Potential therapeutic strategies targeting GPR65 to mitigate psychosine toxicity

These studies contribute to our understanding of Krabbe disease pathophysiology and may inform the development of novel therapeutic approaches.

Inflammatory Pain Studies

Recent research has implicated GPR65 in inflammatory pain mechanisms. A study published in the Proceedings of the National Academy of Sciences indicated that GPR65, as a proton-sensing G-protein-coupled receptor (PS-GPCR), is involved in inflammatory pain, particularly in the context of fibroblast-like synoviocytes that line synovial joints .

Recombinant mouse GPR65 enables researchers to investigate:

  1. The role of GPR65 in nociception and pain signaling

  2. How proton sensing by GPR65 contributes to inflammatory pain responses

  3. Potential therapeutic targets for managing chronic inflammatory pain conditions

This area of research holds promise for addressing the significant unmet clinical need for effective and safe drugs for pain management in chronic inflammatory conditions .

Immune Function Research

Given the predominant expression of GPR65 in lymphoid tissues (spleen, lymph nodes, thymus, and leukocytes), recombinant mouse GPR65 has important applications in immune function research . Studies investigating the role of GPR65 in immune cell responses, particularly in the context of acidic microenvironments characteristic of inflammation, can benefit from using recombinant GPR65 proteins.

Specific research applications include:

  1. Investigating the role of GPR65 in T-cell death and survival mechanisms

  2. Studying how pH sensing by GPR65 modulates immune cell functions

  3. Exploring the potential role of GPR65 in autoimmune and inflammatory disorders

These studies contribute to our understanding of immune regulation and may identify novel therapeutic targets for immune-related disorders.

Tumor Microenvironment Research

GPR65 has been implicated in the regulation of tumor growth, potentially by supporting cell survival in acidic conditions characteristic of tumor microenvironments . The acidic extracellular environment is a hallmark of many solid tumors, and understanding how cells sense and respond to this acidity is crucial for developing targeted cancer therapies.

Recombinant mouse GPR65 enables researchers to:

  1. Study how GPR65 activation in acidic tumor microenvironments affects cancer cell survival and proliferation

  2. Investigate potential therapeutic strategies targeting GPR65 to modulate tumor growth

  3. Explore the role of GPR65 in cancer-related inflammation and immune evasion

These applications highlight the potential significance of GPR65 as a target for cancer research and therapeutic development.

Potential Therapeutic Applications

The multifaceted roles of GPR65 in various physiological and pathological processes suggest several potential therapeutic applications that could emerge from research using recombinant mouse GPR65:

  1. Krabbe Disease Treatment: Understanding the interaction between GPR65 and psychosine could lead to the development of therapies that prevent or mitigate psychosine toxicity in Krabbe disease. Targeting GPR65 might offer a novel approach to protecting oligodendrocytes from psychosine-induced cell death .

  2. Pain Management: Given the involvement of GPR65 in inflammatory pain, particularly in the context of synovial joints, developing modulators of GPR65 activity could provide new strategies for managing chronic inflammatory pain conditions . This is particularly relevant considering the current challenges in pain management and the need for safer and more effective analgesics.

  3. Cancer Therapy: The role of GPR65 in supporting cell survival in acidic tumor microenvironments suggests that targeting this receptor could be a strategy for cancer treatment . Inhibiting GPR65 function might compromise the ability of cancer cells to survive in acidic conditions, potentially enhancing the efficacy of existing cancer therapies.

  4. Bone Disorders: Research indicating that GPR65 inhibits osteoclastic bone resorption suggests potential applications in treating bone loss disorders such as osteoporosis . Activating GPR65 might help prevent excessive bone resorption and maintain bone density.

Technological Advancements

Ongoing advancements in protein production and characterization technologies are likely to enhance the quality and applications of recombinant mouse GPR65:

  1. Improved Expression Systems: Development of optimized expression systems specifically tailored for GPCR production could enhance the yield and quality of recombinant GPR65 proteins. This might include engineered cell lines that provide better membrane protein folding and post-translational modifications.

  2. Structural Biology Techniques: Advanced techniques such as cryo-electron microscopy and X-ray crystallography could provide detailed structural information about GPR65, including its ligand-binding domains and conformational changes upon activation. This structural information would be invaluable for understanding GPR65 function and designing targeted modulators.

  3. High-Throughput Screening Platforms: Development of assays and screening platforms using recombinant GPR65 could facilitate the identification of novel ligands and modulators with potential therapeutic applications.

These technological advancements, coupled with continued basic and translational research, are expected to expand our understanding of GPR65 biology and its potential as a therapeutic target.

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, kindly indicate it when placing the order, and we will accommodate your request.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributors for precise delivery information.
Note: All of our proteins are shipped with standard blue ice packs by default. If dry ice shipment is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life depends on multiple factors, including storage condition, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize development of the specified tag.
Synonyms
Gpr65; Gpcr25; Tdag8; Psychosine receptor; G-protein coupled receptor 65; T-cell death-associated gene 8 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-337
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MAMNSMCIEEQHHLEHYLFPVVYIIVFIVSVPANIGSLCVSFLQAKKENELGIYLFSLSL SDLLYALTLPLWINYTWNKDNWTFSPTLCKGSVFFTYMNFYSSTAFLTCIALDRYLAVVY PLKFSFLRTRRFAFITSLSIWILESFFNSMLLWKDETSVEYCDSDKSNFTLCYDKYPLEK WQINLNLFRTCMGYAIPLITIMICNHKVYRAVRHNQATENSEKRRIIKLLASITLTFVLC FTPFHVMVLIRCVLERDMNVNDKSGWQTFTVYRVTVALTSLNCVADPILYCFVTETGRAD MWNILKLCTRKHNRHQGQKRDILSVSTRDAVELEIID
Uniprot No.

Target Background

Function
This receptor recognizes the glycosphingolipid psychosine (PSY) and several related glycosphingolipids. It plays a crucial role in immune response by maintaining lysosome function and supporting phagocytosis-mediated intracellular bacteria clearance. It may also contribute to activation-induced cell death or differentiation of T-cells.
Gene References Into Functions
  1. TDAG8 might mediate acidosis signals to initiate inflammatory hyperalgesia and establish hyperalgesic priming. PMID: 28145512
  2. Research indicates that TDAG8-dependent microglial acid sensing serves as a unique chemosensor for detecting and translating hypercapnia to fear-associated behavioral and physiological responses. PMID: 27422366
  3. TDAG8 acts as a negative regulator of lung neutrophilic inflammation and injury, partly through the inhibition of chemokine production. PMID: 26690120
  4. TDAG8(-/-) mice exhibited significantly higher sucrose consumption compared to wild-type mice, though sucrose preference was not significantly different between genotypes. PMID: 25770699
  5. Findings suggest that the proton-sensing G protein-coupled receptor GPR65 may be involved in a mechanism that supports the survival of photoreceptors in the degenerating retina. PMID: 26117715
  6. This study demonstrates differential regulation of eosinophils and mast cells in inflammatory tissue, with mast cell viability and accumulation being independent of GPR65. PMID: 24742990
  7. IL-1beta mRNA and protein were attenuated in microglia from TDAG8-deficient mice. TDAG8/PKA signaling inhibits LPS-induced ERK and JNK, which in turn inhibits IL-1beta production. TDAG8 might mediate the proton-induced inhibition of LPS-induced cytokine production. PMID: 24447140
  8. Results suggest that enhancing TDAG8 function represents a new strategy for preventing bone resorption diseases such as osteoporosis. PMID: 24221084
  9. Acidosis promotes Bcl-2 family-mediated evasion of apoptosis: involvement of acid-sensing G protein-coupled receptor Gpr65 signaling to Mek/Erk. PMID: 22685289
  10. Data suggest that one physiological function of TDAG8 is negative regulation of inflammation by inhibiting the production of pro-inflammatory cytokines in T-lymphocytes, macrophages, and splenocytes. PMID: 22445881
  11. TDAG8 is involved in the GC-induced anti-inflammatory actions in macrophages. PMID: 22074830
  12. TDAG8 acts as a negative regulator of inflammation PMID: 21238451
  13. These results support the hypothesis that TDAG8 enhances tumor development by promoting adaptation to the acidic environment to enhance cell survival/proliferation. PMID: 20855608
  14. TDAG8 is one of the proton-sensing GPCRs coupling to adenylyl cyclase and psychosine, and its related lysosphingolipids behave as if they were antagonists against protein-sensing receptors, including TDAG8, GPR4, and OGR1. PMID: 15326175
  15. TDAG8 is a regulator of glucocorticoid-induced apoptosis PMID: 15485889
  16. There is no evidence of a critical role for TDAG8 in immune development, psychosine-mediated inhibition of cytokinesis, and GC-induced cell death. PMID: 16382156
  17. Gene expression of proton-sensing GPCRs is altered in ASIC3 knockout mice. PMID: 17720533
  18. Eosinophil viability is increased in acidic microenvironments in a cAMP- and GPR65-dependent manner. PMID: 19641187

Show More

Hide All

Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Detected in thymus and at low levels in spleen.

Q&A

What is GPR65 and what are its primary functions in physiological systems?

GPR65 (also known as T-cell death-associated gene 8 or TDAG8) is a proton-sensing G-protein-coupled receptor (PS-GPCR) that plays significant roles in inflammatory and immune processes. It functions as a pH sensor, becoming activated in acidic environments typical of inflammatory sites. When activated, GPR65 triggers multiple downstream signaling cascades that mediate inflammatory responses, including cytokine production and cellular activation .

In physiological systems, GPR65 has been implicated in:

  • Mediating inflammatory joint pain through cell-cell interactions

  • Coordinating immune cell function in acidic microenvironments

  • Sensitizing sensory neurons in inflammatory conditions

  • Possibly regulating T-cell apoptosis (hence its alternative name TDAG8)

Recent research has demonstrated that GPR65 on fibroblast-like synoviocytes (FLS) contributes to inflammatory joint pain by secreting proinflammatory mediators that sensitize sensory neurons and recruit additional immune cells .

How does psychosine interact with GPR65, and what are the alternative ligands for this receptor?

Known activators of GPR65 include:

  • Protons (H+) - The primary physiological activator, functioning optimally at pH 6.0-6.5

  • Psychosine - A glycosphingolipid that accumulates in Krabbe disease

  • BTB09089 (BTB) - A synthetic agonist with high selectivity for GPR65

Notably, while protons and BTB both induce robust cAMP accumulation, calcium mobilization, ERK1/2 phosphorylation, and β-arrestin recruitment, psychosine shows a different signaling profile. For instance, psychosine fails to coordinate β-arrestin recruitment to GPR65 while still triggering receptor internalization, suggesting ligand-specific activation mechanisms .

What experimental methods are used to express and purify recombinant mouse GPR65?

Expression and purification of recombinant mouse GPR65 typically employs mammalian expression systems due to the complex post-translational modifications required for proper GPCR folding and function. The methodology involves:

  • Vector Construction:

    • Cloning full-length mouse GPR65 cDNA into a mammalian expression vector

    • Including appropriate tags (such as V5 or polyhistidine) for detection and purification

  • Cell Line Selection and Transfection:

    • Chinese Hamster Ovary (CHO) cells are commonly used for GPCR expression

    • Stable transfection followed by selection of high-expressing clones

  • Expression Optimization:

    • Culturing in chemically defined medium in suspension

    • Fed-batch production with additional feeds and glucose over 10-14 days

  • Purification Strategy:

    • Harvesting and filtering cell culture fluid

    • Two-step chromatographic purification using ion exchange (e.g., Capto Q) followed by hydrophobic interaction chromatography (e.g., Butyl Sepharose)

    • pH adjustment and sterile filtration

    • Concentration using centrifugal spin concentrators

This approach mirrors successful strategies used for other membrane proteins, including recombinant acid ceramidase production in CHO cells as described in the literature .

How can researchers effectively distinguish between GPR65-specific signaling and responses mediated by other proton-sensing receptors?

Differentiating GPR65-specific signaling from other proton-sensing receptors requires a multi-faceted approach that leverages selective tools and genetic models:

  • Use of Selective Agonists:

    • BTB09089 (BTB) has been validated as a selective GPR65 agonist that recapitulates many proton-induced signaling events without activating other proton-sensing receptors

    • BTB shows activation only in cells expressing mGPR65 and not in control cells (mGPR65-CHO vs. CHO: P-adj < 0.0001)

  • CRISPR/Cas9 Knockout Validation:

    • Generate GPR65 knockout cell lines to confirm specificity

    • Compare responses between wild-type, knockout, and rescued (re-expressing GPR65) cell lines

  • Signaling Fingerprint Analysis:

    • Monitor multiple downstream pathways simultaneously (cAMP, Ca2+, ERK1/2, β-arrestin recruitment)

    • The specific pattern of activation across pathways can distinguish GPR65 from other proton sensors

    • For example, assess ERK1/2 phosphorylation in both parental and GPR65-expressing cells (pH 6: Flp-IN, 1.11 ± 0.15%, mGPR65-CHO, 39.51 ± 2.16%, t = −17.756, df = 2.018, P = 0.003)

  • BRET-Based Interaction Assays:

    • Implement Bioluminescence Resonance Energy Transfer (BRET) assays to directly measure:

      • β-arrestin recruitment (using GPR65-RLuc8 and β-arrestin-YFP constructs)

      • Receptor internalization (using GPR65-RLuc8 and membrane-targeted RIT-Venus)

This comprehensive approach allows researchers to confidently attribute observed responses to GPR65 rather than other proton-sensing mechanisms.

What are the optimal experimental conditions for analyzing GPR65-mediated signaling in primary cell cultures?

Establishing optimal conditions for GPR65 signaling analysis in primary cells requires careful consideration of multiple parameters:

  • pH Control and Buffering Systems:

    • Maintain precise pH control (typically pH 6.0-6.5 for proton activation)

    • Use Good's buffers (MES, PIPES) for stable pH maintenance

    • Include proper controls at physiological pH (7.2-7.4)

  • Primary Cell Isolation and Culture:

    • For fibroblast-like synoviocytes (FLS): enzymatic digestion of synovial tissue with collagenase, followed by adherence selection

    • For sensory neurons: dissociation of dorsal root ganglia with specific growth factor supplementation

    • Maintain cells in serum-free conditions during experiments to avoid confounding factors

  • Signaling Readout Selection:

    • cAMP accumulation: use ELISA or HTRF-based detection after phosphodiesterase inhibition

    • Ca2+ mobilization: employ ratiometric imaging with Fura-2 or fluorescent plate readers with Fluo-4

    • ERK1/2 phosphorylation: western blotting or in-cell western techniques

    • Cytokine secretion: multiplex assays to capture the full profile of released mediators

  • Temporal Considerations:

    • Perform time-course experiments (5-60 minutes) to capture both early and late signaling events

    • For long-term outcomes, monitor cells for 24-72 hours under controlled conditions

  • Pharmacological Tools:

    • Use BTB09089 at 1-10 μM as a selective GPR65 agonist

    • Include appropriate vehicle controls

    • Consider antagonist studies with emerging GPR65 inhibitors to confirm receptor specificity

These conditions allow for robust and reproducible analysis of GPR65 signaling in physiologically relevant primary cell systems.

How can recombinant GPR65 be functionally validated to ensure proper folding and signaling capacity?

Functional validation of recombinant GPR65 requires a systematic approach to confirm proper protein folding, membrane localization, and signaling competence:

  • Conformational Analysis:

    • Circular dichroism spectroscopy to assess secondary structure

    • Limited proteolysis to evaluate the accessibility of protease sites

    • Thermal stability assays to determine protein stability

  • Membrane Localization Assessment:

    • Confocal microscopy with fluorescently tagged GPR65

    • Surface biotinylation followed by western blotting

    • BRET assays using RIT-Venus as a plasma membrane marker

  • Ligand Binding Assays:

    • Radioligand binding assays (if available)

    • Fluorescent ligand binding with FRET-based detection

    • Surface plasmon resonance for direct binding kinetics

  • Signaling Competence Validation:

    • cAMP accumulation assays in response to protons, BTB09089, and psychosine

    • Dose-response curves across multiple signaling pathways

  • Functional Reconstitution:

    • Expression in GPR65-null cells to rescue phenotypes

    • Comparison with native receptor responses in appropriate cell types

Through this comprehensive validation approach, researchers can ensure that recombinant GPR65 retains its native structure and function for downstream applications.

How should researchers interpret differences in signaling profiles between protons, psychosine, and synthetic agonists when activating GPR65?

The interpretation of differential signaling profiles requires careful consideration of biased agonism concepts:

  • Signaling Fingerprint Comparison:
    Analyze the maximum effect (Emax) and potency (EC50) across multiple pathways to create a comprehensive signaling profile for each agonist. Based on published data:

    Signaling PathwayProtonsBTB09089Psychosine
    cAMP Accumulation++++++++
    Ca2+ Mobilization+++++++
    ERK1/2 Phosphorylation++++++++
    β-arrestin 1 Recruitment++++++-
    β-arrestin 2 Recruitment++++++-
    Receptor Internalization++++++

    This pattern indicates that BTB09089 most closely mimics proton-induced signaling, while psychosine shows a distinct bias away from β-arrestin recruitment pathways .

  • Receptor Conformational States:
    Different ligands likely stabilize distinct receptor conformational states, resulting in preferential coupling to specific downstream effectors. The absence of psychosine-induced β-arrestin recruitment suggests it induces a conformation that doesn't expose the intracellular domains recognized by arrestins.

  • Physiological Relevance:
    Consider the biological context - psychosine accumulates pathologically in Krabbe disease , while protons increase in inflammatory environments. These different contexts may require distinct signaling outcomes, explaining the evolved ligand bias.

  • Experimental Considerations:

    • Ensure all measurements are made under comparable conditions

    • Control for potential off-target effects, particularly with higher concentrations of synthetic compounds

    • Validate key findings using multiple methodological approaches

These distinctions in signaling profiles have important implications for drug development targeting GPR65, as they suggest opportunities for biased ligands that selectively modulate beneficial pathways while avoiding detrimental ones.

What are the common technical challenges in working with recombinant GPR65 and how can they be addressed?

Working with recombinant GPR65 presents several technical challenges inherent to membrane protein research:

  • Low Expression Yields:

    • Challenge: GPCRs often express poorly in heterologous systems

    • Solution: Optimize codon usage for the expression system; use specialized expression vectors containing chaperon-binding domains; test multiple cell lines; implement temperature shifts during expression; consider fusion partners (T4 lysozyme, BRIL) to enhance stability

  • Protein Aggregation:

    • Challenge: Transmembrane proteins tend to aggregate during purification

    • Solution: Screen multiple detergents and lipid combinations; use GFP-fusion screening to monitor monodispersity; implement size-exclusion chromatography as a final purification step; consider nanodiscs or styrene maleic acid lipid particles (SMALPs) for stabilization

  • Loss of Functional Activity:

    • Challenge: Recombinant GPR65 may lose activity during purification

    • Solution: Validate function at each purification stage; preserve native lipid environment when possible; include stabilizing ligands during purification; consider thermostability assays to identify optimal buffer conditions

  • Inconsistent Signaling Responses:

    • Challenge: Variable results in signaling assays

    • Solution: Carefully control cell density and passage number; ensure consistent receptor expression levels through flow cytometry or western blotting; include internal standards; normalize responses to total protein or cell number

  • Non-specific Binding in Immunoassays:

    • Challenge: High background in detection assays

    • Solution: Implement rigorous blocking protocols; use monoclonal antibodies when available; validate antibody specificity with knockout controls; consider epitope tags for consistent detection

By anticipating and addressing these challenges, researchers can significantly improve the reliability and reproducibility of experiments involving recombinant GPR65.

How can researchers effectively analyze and quantify GPR65-mediated effects in complex cellular systems or animal models?

Analyzing GPR65-mediated effects in complex systems requires integrative approaches that combine molecular, cellular, and behavioral readouts:

  • Cell-Type Specific Isolation and Analysis:

    • Implement FACS-based isolation of specific cell populations from tissues

    • Use single-cell RNA sequencing to identify GPR65-expressing cells and their transcriptional responses

    • Apply laser capture microdissection for spatial resolution of responses

  • Multiplexed Molecular Profiling:

    • Employ RNA-seq or proteomics to characterize global response patterns

    • Use phosphoproteomics to map GPR65-triggered signaling networks

    • Implement cytokine/chemokine arrays to quantify secreted factors

  • Genetic Approaches for Causality Testing:

    • Generate conditional knockout models using Cre-LoxP systems

    • Apply GPR65 overexpression in specific cell types

    • Use CRISPR/Cas9 for precise genetic manipulation

  • Quantitative Assessment in Animal Models:

    • For pain studies: Use objective measures such as von Frey filaments, rotarod testing, and wire-hang tests, as demonstrated in Krabbe disease models (wire-hang maximum tested time: 60s)

    • For inflammatory markers: Quantify tissue immunohistochemistry using standardized scoring systems

    • For behavioral changes: Implement automated systems for unbiased assessment

  • Pharmacological Validation:

    • Use selective agonists (BTB09089) at 1-10 μM concentration

    • Apply emerging GPR65 antagonists as controls

    • Consider dose-response relationships to establish causality

  • Translational Validation:

    • Test findings in human samples (e.g., synovial fluid from osteoarthritis patients)

    • Correlate animal findings with human disease manifestations

    • Consider species differences in GPR65 expression and function

This multilevel approach provides robust evidence for GPR65-specific effects while accounting for the inherent complexity of physiological systems.

What is known about the structural basis of ligand selectivity and biased signaling at GPR65?

Current understanding of GPR65 structure-function relationships remains limited, but emerging data provides insights into ligand selectivity and biased signaling:

  • Ligand Binding Pocket Characteristics:

    • The proton-sensing capability likely involves histidine residues in the extracellular domains that act as pH sensors

    • Psychosine, being a glycosphingolipid, likely interacts with both polar and hydrophobic regions within the binding pocket

    • BTB09089's selective activity suggests a unique binding mode that distinguishes GPR65 from other proton-sensing GPCRs

  • Structural Determinants of Biased Signaling:

    • The differential β-arrestin recruitment observed between ligands (present for protons/BTB, absent for psychosine) indicates distinct conformational states

    • Specific intracellular loop regions likely adopt different orientations depending on the bound ligand

    • These conformational differences presumably affect coupling to G-proteins versus arrestins

  • Molecular Dynamics Insights:

    • While no crystal structure exists for GPR65, homology modeling based on related GPCRs suggests:

      • A typical 7-transmembrane domain structure

      • Extracellular loops forming the entrance to the binding pocket

      • Intracellular regions coupling to signaling partners

  • Future Structural Approaches:

    • Cryo-EM represents a promising approach for determining GPR65 structure

    • Hydrogen-deuterium exchange mass spectrometry could map conformational changes

    • Cross-linking studies may identify key interaction sites for different ligands

Advancing structural knowledge will be crucial for developing selective modulators of GPR65 function and understanding the molecular basis of biased signaling.

How does GPR65 signaling interact with other inflammatory pathways in chronic disease models?

GPR65 signaling does not operate in isolation but rather integrates with multiple inflammatory pathways:

  • Cytokine Network Interactions:

    • GPR65 activation on fibroblast-like synoviocytes (FLS) triggers secretion of proinflammatory mediators

    • These cytokines form feedback loops that can amplify inflammatory responses

    • GPR65-mediated responses may synergize with TNF-α, IL-1β, and IL-6 pathways

  • Neuronal Sensitization Mechanisms:

    • GPR65 activation contributes to neuronal sensitization through direct and indirect mechanisms

    • Direct effects may occur through GPR65 expressed on sensory neurons

    • Indirect effects involve GPR65-activated cells releasing factors that sensitize neurons

  • Acid-Sensing Ion Channel (ASIC) Crosstalk:

    • Protons activate both GPR65 and ASICs in inflammatory environments

    • These pathways may converge on common downstream targets

    • Combined inhibition may provide enhanced anti-inflammatory effects

  • Immune Cell Recruitment and Activation:

    • GPR65 signaling affects immune cell function in acidic microenvironments

    • This may modulate the composition and activity of tissue-infiltrating leukocytes

    • T-cell responses may be particularly affected given GPR65's alternative name (TDAG8)

  • Relevance to Specific Disease Models:

    • Inflammatory arthritis: GPR65 mediates joint pain and inflammation

    • Krabbe disease: Psychosine (which accumulates due to GALC deficiency) activates GPR65, potentially contributing to pathology

    • Other acidosis-associated conditions: GPR65 may play roles in ischemia, cancer, and autoimmune diseases

Understanding these pathway interactions will be essential for developing targeted therapies that modulate GPR65 signaling in specific disease contexts.

What are the emerging therapeutic opportunities targeting GPR65 in inflammatory and neurological disorders?

Emerging research suggests several promising therapeutic approaches targeting GPR65:

  • Selective Antagonism:

    • Development of small molecule GPR65 antagonists could block inflammatory signaling

    • Potential applications in inflammatory joint diseases, where GPR65 mediates pain through cell-cell interactions

    • Challenges include achieving selectivity against other proton-sensing receptors

  • Biased Ligand Development:

    • Given the distinct signaling profiles of different ligands, developing compounds that selectively activate beneficial pathways while avoiding detrimental ones

    • Potential to separate anti-inflammatory effects from pro-nociceptive effects

  • Cell-Type Specific Targeting:

    • Delivery systems that preferentially target GPR65 modulators to specific cell types (e.g., fibroblast-like synoviocytes)

    • This approach could reduce off-target effects while enhancing therapeutic efficacy

  • Combination Therapies:

    • In Krabbe disease, combining GPR65 antagonism with other approaches like substrate reduction therapy (targeting acid ceramidase)

    • For inflammatory diseases, pairing GPR65 modulation with established anti-inflammatory agents

  • Diagnostic Applications:

    • Developing imaging agents that bind GPR65 to visualize inflammatory sites

    • Creating biomarker assays based on GPR65 activation or downstream effects

  • Translational Considerations:

    • Species differences in GPR65 pharmacology must be addressed in preclinical studies

    • Patient stratification based on GPR65 expression or activity could identify responsive subgroups

    • Safety considerations include potential impacts on immune surveillance and acid-base homeostasis

These therapeutic opportunities highlight the potential of GPR65 as a novel target for treating inflammatory and neurological conditions with significant unmet medical needs.

What are the optimal protocols for measuring psychosine levels in biological samples from GPR65 experimental models?

Accurate quantification of psychosine requires specialized analytical methods:

  • Sample Preparation:

    • Homogenize tissue samples in 0.9% sodium chloride solution

    • Add internal standard (1 nM d5-psychosine) and incubate for 2 hours

    • Centrifuge at 13,000 rcf for 5 minutes

    • Process supernatant through solid-phase extraction (SPE) cleanup

    • Dry samples using speedvac

  • UPLC-MS/MS Analysis:

    • Reconstitute dried samples in mobile phase B solution

    • Separate compounds using ultra-performance liquid chromatography

    • Detect and quantify using tandem mass spectrometry (MS/MS)

    • Use multiple reaction monitoring (MRM) for high sensitivity and specificity

  • Validation Parameters:

    • Establish standard curves using purified psychosine

    • Determine limits of detection and quantification

    • Assess intra- and inter-assay variability

    • Confirm absence of matrix effects

  • Data Analysis and Interpretation:

    • Normalize results to protein concentration or tissue weight

    • Compare to appropriate controls (wild-type, disease models)

    • Consider age-dependent changes in psychosine levels

This methodology allows for accurate quantification of psychosine in various tissues, including brain, sciatic nerve, liver, and spleen, enabling correlation of psychosine levels with GPR65 activation status in experimental models .

How can researchers effectively design and interpret GPR65 knockout or knockdown experiments?

Designing rigorous genetic manipulation studies for GPR65 requires careful consideration of multiple factors:

  • Model Selection:

    • Global knockout: Useful for understanding systemic roles but may have compensatory mechanisms

    • Conditional knockout: Allows tissue- or time-specific deletion to avoid developmental effects

    • Knockdown: Provides intermediate reduction in expression, potentially avoiding complete loss-of-function consequences

  • Validation Strategy:

    • Genomic verification: PCR-based genotyping with specific primers

    • RNA expression: RT-qPCR to confirm transcript reduction

    • Protein expression: Western blotting or immunohistochemistry

    • Functional validation: Measure responses to selective agonists (BTB09089)

  • Control Selection:

    • Wild-type littermates as primary controls

    • Heterozygous animals to assess gene dosage effects

    • Rescue experiments through re-expression to confirm phenotype specificity

  • Phenotypic Analysis:

    • Comprehensive assessment across multiple systems

    • Baseline versus challenged conditions (e.g., inflammatory stimuli)

    • Age-dependent phenotypes

    • Sex-specific differences

  • Interpretation Considerations:

    • Distinguish direct versus indirect effects

    • Consider compensatory mechanisms (e.g., upregulation of other proton sensors)

    • Assess cell-autonomous versus non-cell-autonomous effects

    • Interpret behavioral changes in the context of molecular and cellular alterations

The Twi/FD mouse model (GALC-/-, Asah1-/-) provides an excellent example of genetic manipulation to study related pathways, demonstrating how double-knockout approaches can reveal functional relationships between interconnected systems .

What advanced imaging techniques can be applied to study GPR65 localization and trafficking in live cells?

Advanced imaging approaches provide powerful tools for investigating GPR65 dynamics:

  • Super-Resolution Microscopy:

    • Stimulated Emission Depletion (STED) microscopy: Achieves resolution down to ~50 nm

    • Photoactivated Localization Microscopy (PALM): Uses photoactivatable fluorophores for single-molecule localization

    • Stochastic Optical Reconstruction Microscopy (STORM): Provides nanoscale resolution for tracking receptor clusters

  • Live-Cell Fluorescence Techniques:

    • Total Internal Reflection Fluorescence (TIRF): Visualizes membrane-proximal events with high signal-to-noise ratio

    • Fluorescence Recovery After Photobleaching (FRAP): Measures lateral mobility of GPR65 in the membrane

    • Fluorescence Correlation Spectroscopy (FCS): Analyzes diffusion characteristics and molecular interactions

  • Resonance Energy Transfer Approaches:

    • Förster Resonance Energy Transfer (FRET): Detects molecular proximity between GPR65 and interaction partners

    • Bioluminescence Resonance Energy Transfer (BRET): Monitors interactions without external illumination, reducing phototoxicity

    • BRET assays with GPR65-RLuc8 and β-arrestin-YFP or RIT-Venus constructs have been successfully implemented

  • Spatiotemporal Analysis Tools:

    • Fluorescence Lifetime Imaging Microscopy (FLIM): Measures the excited-state lifetime of fluorophores, providing information independent of concentration

    • Single-Particle Tracking (SPT): Follows individual receptor molecules to analyze movement patterns

    • Optogenetic approaches: Allows precise temporal control of GPR65 activation

  • Multi-Modal Imaging:

    • Correlative Light and Electron Microscopy (CLEM): Combines fluorescence localization with ultrastructural context

    • Expansion Microscopy: Physically enlarges specimens to improve resolution with standard equipment

These advanced imaging approaches enable researchers to visualize GPR65 trafficking from the cell surface to endosomal compartments, determine its interactions with signaling partners, and assess how these dynamics change in response to different ligands or cellular conditions.

Frequently Asked Questions (FAQs) for Researchers: Recombinant Mouse Psychosine Receptor (GPR65)

This comprehensive FAQ collection addresses common research questions about the recombinant mouse psychosine receptor (GPR65), ranging from basic characterization to advanced experimental approaches. These questions reflect actual research scenarios encountered in laboratory settings and provide methodologically oriented answers based on recent scientific literature.

What is GPR65 and what are its primary functions in physiological systems?

GPR65 (also known as T-cell death-associated gene 8 or TDAG8) is a proton-sensing G-protein-coupled receptor (PS-GPCR) that plays significant roles in inflammatory and immune processes. It functions as a pH sensor, becoming activated in acidic environments typical of inflammatory sites. When activated, GPR65 triggers multiple downstream signaling cascades that mediate inflammatory responses, including cytokine production and cellular activation .

In physiological systems, GPR65 has been implicated in:

  • Mediating inflammatory joint pain through cell-cell interactions

  • Coordinating immune cell function in acidic microenvironments

  • Sensitizing sensory neurons in inflammatory conditions

  • Possibly regulating T-cell apoptosis (hence its alternative name TDAG8)

Recent research has demonstrated that GPR65 on fibroblast-like synoviocytes (FLS) contributes to inflammatory joint pain by secreting proinflammatory mediators that sensitize sensory neurons and recruit additional immune cells .

How does psychosine interact with GPR65, and what are the alternative ligands for this receptor?

Known activators of GPR65 include:

  • Protons (H+) - The primary physiological activator, functioning optimally at pH 6.0-6.5

  • Psychosine - A glycosphingolipid that accumulates in Krabbe disease

  • BTB09089 (BTB) - A synthetic agonist with high selectivity for GPR65

Notably, while protons and BTB both induce robust cAMP accumulation, calcium mobilization, ERK1/2 phosphorylation, and β-arrestin recruitment, psychosine shows a different signaling profile. For instance, psychosine fails to coordinate β-arrestin recruitment to GPR65 while still triggering receptor internalization, suggesting ligand-specific activation mechanisms .

What experimental methods are used to express and purify recombinant mouse GPR65?

Expression and purification of recombinant mouse GPR65 typically employs mammalian expression systems due to the complex post-translational modifications required for proper GPCR folding and function. The methodology involves:

  • Vector Construction:

    • Cloning full-length mouse GPR65 cDNA into a mammalian expression vector

    • Including appropriate tags (such as V5 or polyhistidine) for detection and purification

  • Cell Line Selection and Transfection:

    • Chinese Hamster Ovary (CHO) cells are commonly used for GPCR expression

    • Stable transfection followed by selection of high-expressing clones

  • Expression Optimization:

    • Culturing in chemically defined medium in suspension

    • Fed-batch production with additional feeds and glucose over 10-14 days

  • Purification Strategy:

    • Harvesting and filtering cell culture fluid

    • Two-step chromatographic purification using ion exchange (e.g., Capto Q) followed by hydrophobic interaction chromatography (e.g., Butyl Sepharose)

    • pH adjustment and sterile filtration

    • Concentration using centrifugal spin concentrators

This approach mirrors successful strategies used for other membrane proteins, including recombinant acid ceramidase production in CHO cells as described in the literature .

How can researchers effectively distinguish between GPR65-specific signaling and responses mediated by other proton-sensing receptors?

Differentiating GPR65-specific signaling from other proton-sensing receptors requires a multi-faceted approach that leverages selective tools and genetic models:

  • Use of Selective Agonists:

    • BTB09089 (BTB) has been validated as a selective GPR65 agonist that recapitulates many proton-induced signaling events without activating other proton-sensing receptors

    • BTB shows activation only in cells expressing mGPR65 and not in control cells (mGPR65-CHO vs. CHO: P-adj < 0.0001)

  • CRISPR/Cas9 Knockout Validation:

    • Generate GPR65 knockout cell lines to confirm specificity

    • Compare responses between wild-type, knockout, and rescued (re-expressing GPR65) cell lines

  • Signaling Fingerprint Analysis:

    • Monitor multiple downstream pathways simultaneously (cAMP, Ca2+, ERK1/2, β-arrestin recruitment)

    • The specific pattern of activation across pathways can distinguish GPR65 from other proton sensors

    • For example, assess ERK1/2 phosphorylation in both parental and GPR65-expressing cells (pH 6: Flp-IN, 1.11 ± 0.15%, mGPR65-CHO, 39.51 ± 2.16%, t = −17.756, df = 2.018, P = 0.003)

  • BRET-Based Interaction Assays:

    • Implement Bioluminescence Resonance Energy Transfer (BRET) assays to directly measure:

      • β-arrestin recruitment (using GPR65-RLuc8 and β-arrestin-YFP constructs)

      • Receptor internalization (using GPR65-RLuc8 and membrane-targeted RIT-Venus)

This comprehensive approach allows researchers to confidently attribute observed responses to GPR65 rather than other proton-sensing mechanisms.

What are the optimal experimental conditions for analyzing GPR65-mediated signaling in primary cell cultures?

Establishing optimal conditions for GPR65 signaling analysis in primary cells requires careful consideration of multiple parameters:

  • pH Control and Buffering Systems:

    • Maintain precise pH control (typically pH 6.0-6.5 for proton activation)

    • Use Good's buffers (MES, PIPES) for stable pH maintenance

    • Include proper controls at physiological pH (7.2-7.4)

  • Primary Cell Isolation and Culture:

    • For fibroblast-like synoviocytes (FLS): enzymatic digestion of synovial tissue with collagenase, followed by adherence selection

    • For sensory neurons: dissociation of dorsal root ganglia with specific growth factor supplementation

    • Maintain cells in serum-free conditions during experiments to avoid confounding factors

  • Signaling Readout Selection:

    • cAMP accumulation: use ELISA or HTRF-based detection after phosphodiesterase inhibition

    • Ca2+ mobilization: employ ratiometric imaging with Fura-2 or fluorescent plate readers with Fluo-4

    • ERK1/2 phosphorylation: western blotting or in-cell western techniques

    • Cytokine secretion: multiplex assays to capture the full profile of released mediators

  • Temporal Considerations:

    • Perform time-course experiments (5-60 minutes) to capture both early and late signaling events

    • For long-term outcomes, monitor cells for 24-72 hours under controlled conditions

  • Pharmacological Tools:

    • Use BTB09089 at 1-10 μM as a selective GPR65 agonist

    • Include appropriate vehicle controls

    • Consider antagonist studies with emerging GPR65 inhibitors to confirm receptor specificity

These conditions allow for robust and reproducible analysis of GPR65 signaling in physiologically relevant primary cell systems.

How can recombinant GPR65 be functionally validated to ensure proper folding and signaling capacity?

Functional validation of recombinant GPR65 requires a systematic approach to confirm proper protein folding, membrane localization, and signaling competence:

  • Conformational Analysis:

    • Circular dichroism spectroscopy to assess secondary structure

    • Limited proteolysis to evaluate the accessibility of protease sites

    • Thermal stability assays to determine protein stability

  • Membrane Localization Assessment:

    • Confocal microscopy with fluorescently tagged GPR65

    • Surface biotinylation followed by western blotting

    • BRET assays using RIT-Venus as a plasma membrane marker

  • Ligand Binding Assays:

    • Radioligand binding assays (if available)

    • Fluorescent ligand binding with FRET-based detection

    • Surface plasmon resonance for direct binding kinetics

  • Signaling Competence Validation:

    • cAMP accumulation assays in response to protons, BTB09089, and psychosine

    • Dose-response curves across multiple signaling pathways

  • Functional Reconstitution:

    • Expression in GPR65-null cells to rescue phenotypes

    • Comparison with native receptor responses in appropriate cell types

Through this comprehensive validation approach, researchers can ensure that recombinant GPR65 retains its native structure and function for downstream applications.

How should researchers interpret differences in signaling profiles between protons, psychosine, and synthetic agonists when activating GPR65?

The interpretation of differential signaling profiles requires careful consideration of biased agonism concepts:

  • Signaling Fingerprint Comparison:
    Analyze the maximum effect (Emax) and potency (EC50) across multiple pathways to create a comprehensive signaling profile for each agonist. Based on published data:

    Signaling PathwayProtonsBTB09089Psychosine
    cAMP Accumulation++++++++
    Ca2+ Mobilization+++++++
    ERK1/2 Phosphorylation++++++++
    β-arrestin 1 Recruitment++++++-
    β-arrestin 2 Recruitment++++++-
    Receptor Internalization++++++

    This pattern indicates that BTB09089 most closely mimics proton-induced signaling, while psychosine shows a distinct bias away from β-arrestin recruitment pathways .

  • Receptor Conformational States:
    Different ligands likely stabilize distinct receptor conformational states, resulting in preferential coupling to specific downstream effectors. The absence of psychosine-induced β-arrestin recruitment suggests it induces a conformation that doesn't expose the intracellular domains recognized by arrestins.

  • Physiological Relevance:
    Consider the biological context - psychosine accumulates pathologically in Krabbe disease , while protons increase in inflammatory environments. These different contexts may require distinct signaling outcomes, explaining the evolved ligand bias.

  • Experimental Considerations:

    • Ensure all measurements are made under comparable conditions

    • Control for potential off-target effects, particularly with higher concentrations of synthetic compounds

    • Validate key findings using multiple methodological approaches

These distinctions in signaling profiles have important implications for drug development targeting GPR65, as they suggest opportunities for biased ligands that selectively modulate beneficial pathways while avoiding detrimental ones.

What are the common technical challenges in working with recombinant GPR65 and how can they be addressed?

Working with recombinant GPR65 presents several technical challenges inherent to membrane protein research:

  • Low Expression Yields:

    • Challenge: GPCRs often express poorly in heterologous systems

    • Solution: Optimize codon usage for the expression system; use specialized expression vectors containing chaperon-binding domains; test multiple cell lines; implement temperature shifts during expression; consider fusion partners (T4 lysozyme, BRIL) to enhance stability

  • Protein Aggregation:

    • Challenge: Transmembrane proteins tend to aggregate during purification

    • Solution: Screen multiple detergents and lipid combinations; use GFP-fusion screening to monitor monodispersity; implement size-exclusion chromatography as a final purification step; consider nanodiscs or styrene maleic acid lipid particles (SMALPs) for stabilization

  • Loss of Functional Activity:

    • Challenge: Recombinant GPR65 may lose activity during purification

    • Solution: Validate function at each purification stage; preserve native lipid environment when possible; include stabilizing ligands during purification; consider thermostability assays to identify optimal buffer conditions

  • Inconsistent Signaling Responses:

    • Challenge: Variable results in signaling assays

    • Solution: Carefully control cell density and passage number; ensure consistent receptor expression levels through flow cytometry or western blotting; include internal standards; normalize responses to total protein or cell number

  • Non-specific Binding in Immunoassays:

    • Challenge: High background in detection assays

    • Solution: Implement rigorous blocking protocols; use monoclonal antibodies when available; validate antibody specificity with knockout controls; consider epitope tags for consistent detection

By anticipating and addressing these challenges, researchers can significantly improve the reliability and reproducibility of experiments involving recombinant GPR65.

How can researchers effectively analyze and quantify GPR65-mediated effects in complex cellular systems or animal models?

Analyzing GPR65-mediated effects in complex systems requires integrative approaches that combine molecular, cellular, and behavioral readouts:

  • Cell-Type Specific Isolation and Analysis:

    • Implement FACS-based isolation of specific cell populations from tissues

    • Use single-cell RNA sequencing to identify GPR65-expressing cells and their transcriptional responses

    • Apply laser capture microdissection for spatial resolution of responses

  • Multiplexed Molecular Profiling:

    • Employ RNA-seq or proteomics to characterize global response patterns

    • Use phosphoproteomics to map GPR65-triggered signaling networks

    • Implement cytokine/chemokine arrays to quantify secreted factors

  • Genetic Approaches for Causality Testing:

    • Generate conditional knockout models using Cre-LoxP systems

    • Apply GPR65 overexpression in specific cell types

    • Use CRISPR/Cas9 for precise genetic manipulation

  • Quantitative Assessment in Animal Models:

    • For pain studies: Use objective measures such as von Frey filaments, rotarod testing, and wire-hang tests, as demonstrated in Krabbe disease models (wire-hang maximum tested time: 60s)

    • For inflammatory markers: Quantify tissue immunohistochemistry using standardized scoring systems

    • For behavioral changes: Implement automated systems for unbiased assessment

  • Pharmacological Validation:

    • Use selective agonists (BTB09089) at 1-10 μM concentration

    • Apply emerging GPR65 antagonists as controls

    • Consider dose-response relationships to establish causality

  • Translational Validation:

    • Test findings in human samples (e.g., synovial fluid from osteoarthritis patients)

    • Correlate animal findings with human disease manifestations

    • Consider species differences in GPR65 expression and function

This multilevel approach provides robust evidence for GPR65-specific effects while accounting for the inherent complexity of physiological systems.

What is known about the structural basis of ligand selectivity and biased signaling at GPR65?

Current understanding of GPR65 structure-function relationships remains limited, but emerging data provides insights into ligand selectivity and biased signaling:

  • Ligand Binding Pocket Characteristics:

    • The proton-sensing capability likely involves histidine residues in the extracellular domains that act as pH sensors

    • Psychosine, being a glycosphingolipid, likely interacts with both polar and hydrophobic regions within the binding pocket

    • BTB09089's selective activity suggests a unique binding mode that distinguishes GPR65 from other proton-sensing GPCRs

  • Structural Determinants of Biased Signaling:

    • The differential β-arrestin recruitment observed between ligands (present for protons/BTB, absent for psychosine) indicates distinct conformational states

    • Specific intracellular loop regions likely adopt different orientations depending on the bound ligand

    • These conformational differences presumably affect coupling to G-proteins versus arrestins

  • Molecular Dynamics Insights:

    • While no crystal structure exists for GPR65, homology modeling based on related GPCRs suggests:

      • A typical 7-transmembrane domain structure

      • Extracellular loops forming the entrance to the binding pocket

      • Intracellular regions coupling to signaling partners

  • Future Structural Approaches:

    • Cryo-EM represents a promising approach for determining GPR65 structure

    • Hydrogen-deuterium exchange mass spectrometry could map conformational changes

    • Cross-linking studies may identify key interaction sites for different ligands

Advancing structural knowledge will be crucial for developing selective modulators of GPR65 function and understanding the molecular basis of biased signaling.

How does GPR65 signaling interact with other inflammatory pathways in chronic disease models?

GPR65 signaling does not operate in isolation but rather integrates with multiple inflammatory pathways:

  • Cytokine Network Interactions:

    • GPR65 activation on fibroblast-like synoviocytes (FLS) triggers secretion of proinflammatory mediators

    • These cytokines form feedback loops that can amplify inflammatory responses

    • GPR65-mediated responses may synergize with TNF-α, IL-1β, and IL-6 pathways

  • Neuronal Sensitization Mechanisms:

    • GPR65 activation contributes to neuronal sensitization through direct and indirect mechanisms

    • Direct effects may occur through GPR65 expressed on sensory neurons

    • Indirect effects involve GPR65-activated cells releasing factors that sensitize neurons

  • Acid-Sensing Ion Channel (ASIC) Crosstalk:

    • Protons activate both GPR65 and ASICs in inflammatory environments

    • These pathways may converge on common downstream targets

    • Combined inhibition may provide enhanced anti-inflammatory effects

  • Immune Cell Recruitment and Activation:

    • GPR65 signaling affects immune cell function in acidic microenvironments

    • This may modulate the composition and activity of tissue-infiltrating leukocytes

    • T-cell responses may be particularly affected given GPR65's alternative name (TDAG8)

  • Relevance to Specific Disease Models:

    • Inflammatory arthritis: GPR65 mediates joint pain and inflammation

    • Krabbe disease: Psychosine (which accumulates due to GALC deficiency) activates GPR65, potentially contributing to pathology

    • Other acidosis-associated conditions: GPR65 may play roles in ischemia, cancer, and autoimmune diseases

Understanding these pathway interactions will be essential for developing targeted therapies that modulate GPR65 signaling in specific disease contexts.

What are the emerging therapeutic opportunities targeting GPR65 in inflammatory and neurological disorders?

Emerging research suggests several promising therapeutic approaches targeting GPR65:

  • Selective Antagonism:

    • Development of small molecule GPR65 antagonists could block inflammatory signaling

    • Potential applications in inflammatory joint diseases, where GPR65 mediates pain through cell-cell interactions

    • Challenges include achieving selectivity against other proton-sensing receptors

  • Biased Ligand Development:

    • Given the distinct signaling profiles of different ligands, developing compounds that selectively activate beneficial pathways while avoiding detrimental ones

    • Potential to separate anti-inflammatory effects from pro-nociceptive effects

  • Cell-Type Specific Targeting:

    • Delivery systems that preferentially target GPR65 modulators to specific cell types (e.g., fibroblast-like synoviocytes)

    • This approach could reduce off-target effects while enhancing therapeutic efficacy

  • Combination Therapies:

    • In Krabbe disease, combining GPR65 antagonism with other approaches like substrate reduction therapy (targeting acid ceramidase)

    • For inflammatory diseases, pairing GPR65 modulation with established anti-inflammatory agents

  • Diagnostic Applications:

    • Developing imaging agents that bind GPR65 to visualize inflammatory sites

    • Creating biomarker assays based on GPR65 activation or downstream effects

  • Translational Considerations:

    • Species differences in GPR65 pharmacology must be addressed in preclinical studies

    • Patient stratification based on GPR65 expression or activity could identify responsive subgroups

    • Safety considerations include potential impacts on immune surveillance and acid-base homeostasis

These therapeutic opportunities highlight the potential of GPR65 as a novel target for treating inflammatory and neurological conditions with significant unmet medical needs.

What are the optimal protocols for measuring psychosine levels in biological samples from GPR65 experimental models?

Accurate quantification of psychosine requires specialized analytical methods:

  • Sample Preparation:

    • Homogenize tissue samples in 0.9% sodium chloride solution

    • Add internal standard (1 nM d5-psychosine) and incubate for 2 hours

    • Centrifuge at 13,000 rcf for 5 minutes

    • Process supernatant through solid-phase extraction (SPE) cleanup

    • Dry samples using speedvac

  • UPLC-MS/MS Analysis:

    • Reconstitute dried samples in mobile phase B solution

    • Separate compounds using ultra-performance liquid chromatography

    • Detect and quantify using tandem mass spectrometry (MS/MS)

    • Use multiple reaction monitoring (MRM) for high sensitivity and specificity

  • Validation Parameters:

    • Establish standard curves using purified psychosine

    • Determine limits of detection and quantification

    • Assess intra- and inter-assay variability

    • Confirm absence of matrix effects

  • Data Analysis and Interpretation:

    • Normalize results to protein concentration or tissue weight

    • Compare to appropriate controls (wild-type, disease models)

    • Consider age-dependent changes in psychosine levels

This methodology allows for accurate quantification of psychosine in various tissues, including brain, sciatic nerve, liver, and spleen, enabling correlation of psychosine levels with GPR65 activation status in experimental models .

How can researchers effectively design and interpret GPR65 knockout or knockdown experiments?

Designing rigorous genetic manipulation studies for GPR65 requires careful consideration of multiple factors:

  • Model Selection:

    • Global knockout: Useful for understanding systemic roles but may have compensatory mechanisms

    • Conditional knockout: Allows tissue- or time-specific deletion to avoid developmental effects

    • Knockdown: Provides intermediate reduction in expression, potentially avoiding complete loss-of-function consequences

  • Validation Strategy:

    • Genomic verification: PCR-based genotyping with specific primers

    • RNA expression: RT-qPCR to confirm transcript reduction

    • Protein expression: Western blotting or immunohistochemistry

    • Functional validation: Measure responses to selective agonists (BTB09089)

  • Control Selection:

    • Wild-type littermates as primary controls

    • Heterozygous animals to assess gene dosage effects

    • Rescue experiments through re-expression to confirm phenotype specificity

  • Phenotypic Analysis:

    • Comprehensive assessment across multiple systems

    • Baseline versus challenged conditions (e.g., inflammatory stimuli)

    • Age-dependent phenotypes

    • Sex-specific differences

  • Interpretation Considerations:

    • Distinguish direct versus indirect effects

    • Consider compensatory mechanisms (e.g., upregulation of other proton sensors)

    • Assess cell-autonomous versus non-cell-autonomous effects

    • Interpret behavioral changes in the context of molecular and cellular alterations

The Twi/FD mouse model (GALC-/-, Asah1-/-) provides an excellent example of genetic manipulation to study related pathways, demonstrating how double-knockout approaches can reveal functional relationships between interconnected systems .

What advanced imaging techniques can be applied to study GPR65 localization and trafficking in live cells?

Advanced imaging approaches provide powerful tools for investigating GPR65 dynamics:

  • Super-Resolution Microscopy:

    • Stimulated Emission Depletion (STED) microscopy: Achieves resolution down to ~50 nm

    • Photoactivated Localization Microscopy (PALM): Uses photoactivatable fluorophores for single-molecule localization

    • Stochastic Optical Reconstruction Microscopy (STORM): Provides nanoscale resolution for tracking receptor clusters

  • Live-Cell Fluorescence Techniques:

    • Total Internal Reflection Fluorescence (TIRF): Visualizes membrane-proximal events with high signal-to-noise ratio

    • Fluorescence Recovery After Photobleaching (FRAP): Measures lateral mobility of GPR65 in the membrane

    • Fluorescence Correlation Spectroscopy (FCS): Analyzes diffusion characteristics and molecular interactions

  • Resonance Energy Transfer Approaches:

    • Förster Resonance Energy Transfer (FRET): Detects molecular proximity between GPR65 and interaction partners

    • Bioluminescence Resonance Energy Transfer (BRET): Monitors interactions without external illumination, reducing phototoxicity

    • BRET assays with GPR65-RLuc8 and β-arrestin-YFP or RIT-Venus constructs have been successfully implemented

  • Spatiotemporal Analysis Tools:

    • Fluorescence Lifetime Imaging Microscopy (FLIM): Measures the excited-state lifetime of fluorophores, providing information independent of concentration

    • Single-Particle Tracking (SPT): Follows individual receptor molecules to analyze movement patterns

    • Optogenetic approaches: Allows precise temporal control of GPR65 activation

  • Multi-Modal Imaging:

    • Correlative Light and Electron Microscopy (CLEM): Combines fluorescence localization with ultrastructural context

    • Expansion Microscopy: Physically enlarges specimens to improve resolution with standard equipment

These advanced imaging approaches enable researchers to visualize GPR65 trafficking from the cell surface to endosomal compartments, determine its interactions with signaling partners, and assess how these dynamics change in response to different ligands or cellular conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.