Recombinant Mouse Putative small membrane protein NID67 (Nid67)
Shipped with Ice Packs 
In Stock 
Description
Hematopoietic Deficiencies
Deletion of the Cd74-Nid67 chromosomal region in mice caused:
Key findings:
Mechanistic Associations
Interacting Pathways:
-
p53 pathway: Bone marrow cells show elevated p53 expression and apoptosis in Cd74-Nid67 deletion models
-
Ion channel regulation: Structural similarity to small membrane proteins modulating ion transport
Candidate Genes in the Cd74-Nid67 Interval:
| Gene | Protein Function | Relevance to Phenotype |
|---|---|---|
| Rps14 | Ribosomal subunit | Linked to anemia |
| Ndst1 | Heparan sulfate modification | Unclear |
| Dctn4 | Cytoskeletal dynamics | Unclear |
Research Applications
-
Recombinant Protein Use:
-
Experimental Models:
Unresolved Questions
Product Specs
Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your requests whenever possible.
Note: We prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your requests whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Note: All of our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, storage temperature, and the protein's inherent stability. Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot the protein for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us and we will prioritize developing the specified tag.
Synonyms
Smim3; Nid67; Small integral membrane protein 3; NGF-induced differentiation clone 67 protein; Small membrane protein NID67
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-60
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Smim3
Target Protein Sequence
MDAITQSPVDAVLPKHILDIWAIVLIILATIVIMTSLFLCPATAVIIYRMRTHPVLNGAA
Uniprot No.
Target Background
Database Links
Subcellular Location
Membrane; Single-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
