Recombinant Mouse Putative small membrane protein NID67 (Nid67)

Shipped with Ice Packs
In Stock

Description

Hematopoietic Deficiencies

Deletion of the Cd74-Nid67 chromosomal region in mice caused:

ParameterChange vs. Controlsp53 Dependency
Red blood cell count↓ 40-50%Reversed in Trp53⁻/⁻ mice
Hemoglobin levelsSignificantly ↓Reversed in Trp53⁻/⁻ mice
CFU-E progenitors↓ 80%Restored by p53 knockout
CMP/MEP populations↓ 60-70%Restored by p53 knockout

Key findings:

  • Triggers p53-mediated apoptosis in erythroid progenitors

  • Associated with macrocytic anemia resembling 5q- syndrome

Mechanistic Associations

Interacting Pathways:

  • p53 pathway: Bone marrow cells show elevated p53 expression and apoptosis in Cd74-Nid67 deletion models

  • Ion channel regulation: Structural similarity to small membrane proteins modulating ion transport

Candidate Genes in the Cd74-Nid67 Interval:

GeneProtein FunctionRelevance to Phenotype
Rps14Ribosomal subunitLinked to anemia
Ndst1Heparan sulfate modificationUnclear
Dctn4Cytoskeletal dynamicsUnclear

Research Applications

  • Recombinant Protein Use:

    • Commercial availability for in vitro studies (e.g., signaling assays)

    • Tool for investigating p53-dependent hematopoietic defects

  • Experimental Models:

    • Cd74-Nid67 deletion mice for 5q- syndrome research

    • PC12 cell differentiation studies

Unresolved Questions

  1. Does NID67 directly interact with ion channels or ribosomal components?

  2. Why is its expression highest in non-hematopoietic tissues (e.g., heart)?

  3. Mechanism linking transmembrane structure to p53 activation

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your requests whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, storage temperature, and the protein's inherent stability. Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot the protein for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us and we will prioritize developing the specified tag.
Synonyms
Smim3; Nid67; Small integral membrane protein 3; NGF-induced differentiation clone 67 protein; Small membrane protein NID67
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-60
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Smim3
Target Protein Sequence
MDAITQSPVDAVLPKHILDIWAIVLIILATIVIMTSLFLCPATAVIIYRMRTHPVLNGAA
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Single-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.