Recombinant Mouse Pyroglutamylated RFamide peptide receptor (Qrfpr)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us for preferential development.
Synonyms
Qrfpr; Gpr103; Pyroglutamylated RF-amide peptide receptor; AQ27; G-protein coupled receptor 103; Orexigenic neuropeptide QRFP receptor; SP9155
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-433
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MQALNITAEQFSRLLSAHNLTREQFIHRYGLRPLVYTPELPARAKLAFALAGALIFALAL FGNSLVIYVVTRSKAMRTVTNIFICSLALSDLLIAFFCIPVTMLQNISDKWLGGAFICKM VPFVQSTAVVTEILTMTCIAVERHQGLIHPFKMKWQYTTRRAFTILGVVWLAAIIVGSPM WHVQRLEIKYDFLYEKEHVCCLEEWASPMHQRIYTTFILVILFLLPLVVMLVLYSKIGYE LWIKKRVGDSSALQTIHGKEMSKIARKKKRAVVMMVTVVALFAACWAPFHVVHMMVEYSN FEKEYDDVTIKMVFAVAQTIGFFNSICNPFVYAFMNENFKKNFLSAVCYCIVRETFSPGQ KPGNSGISMMQKRAKLSRSQRPVAEAKGDLFSDANVDVKLCEQPGEKRQLKRQLAFFSSE LSENSTFGSGHEL
Uniprot No.

Target Background

Function

This receptor acts as a receptor for the orexigenic neuropeptide QRFP. Its activity is mediated by G proteins, modulating adenylate cyclase activity and intracellular calcium levels.

Gene References Into Functions
  1. In a study using an elevated plus-maze test, treatment of mice with the synthetic GPR103 receptor agonist peptide P550 revealed effects on anxious behavior. PMID: 27224020
  2. This publication details the characterization and tissue distribution of the GPR103 ligand SP9155. PMID: 12714592
  3. Osteopenia observed in GPR103-/- mice may be directly linked to the loss of GPR103 expression in bone. PMID: 16382160
  4. QRFP and GPR103A/B appear to regulate various neuroendocrine and behavioral functions, suggesting their involvement in metabolic syndrome. PMID: 16648250
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed widely in the brain with high levels in the cortex and hypothalamus, and moderate levels in the brain stem, caudate nucleus, midbrain hippocampus, thalamus, trigeminal ganglia and spinal cord. Particularly strong expression detected in the mitra

Q&A

What is the Pyroglutamylated RFamide Peptide Receptor (Qrfpr) and what are its key characteristics?

Pyroglutamylated RFamide Peptide Receptor (Qrfpr), also known as G-protein coupled receptor 103 (GPR103) or orexigenic neuropeptide QRFP receptor, belongs to the class A G-protein-coupled receptor (GPCR) family. The receptor is activated by the pyroglutamylated RF-amide peptide (QRFP), which contains the characteristic RF-amide motif at its C-terminus .

In mice, Qrfpr is predominantly expressed in the brain, heart, kidney, retina, and testis. Like other GPCRs, it contains seven transmembrane domains and couples primarily to Gq and Gi/o proteins upon activation by its endogenous ligands . The mouse Qrfpr gene encodes a protein that plays critical roles in energy homeostasis, appetite regulation, and bone formation .

What are the known endogenous ligands for mouse Qrfpr?

Mouse Qrfpr is activated by QRFP peptides, with the most well-characterized forms being QRFP-26 (26RFa) and QRFP-43 (43RFa). The QRFP-26 is a 26-amino acid RF-amide peptide that functions as a high-affinity ligand for Qrfpr . The 43-amino acid QRFP peptide (QRFP-43) is a longer form that exhibits full agonistic activity with Qrfpr .

Both peptides share the conserved C-terminal RF-amide sequence that is characteristic of the RF-amide peptide family. This C-terminal motif is crucial for receptor binding and activation, while the N-terminal regions contribute to binding affinity and receptor selectivity .

What physiological functions are associated with mouse Qrfpr?

Mouse Qrfpr is involved in multiple physiological processes:

  • Energy metabolism and appetite regulation: The Qrfpr system plays critical roles in regulating feeding behavior and energy homeostasis, making it a potential target for treating obesity and eating disorders .

  • Skeletal development: Mice with Qrfpr mutations display kyphosis (abnormal curvature of the spine), abnormal vertebrae morphology and development, and osteopenia (reduced bone mineral density) of the vertebrae .

  • Endocrine function: Activation of Qrfpr can influence hormone secretion. In rats, intravenous administration of QRFP causes the release of aldosterone, suggesting a regulatory role in adrenal gland function .

  • Adipogenesis regulation: Research suggests that Qrfpr works in an autocrine/paracrine manner to regulate adipogenesis, potentially contributing to obesity development .

What is the structural basis for QRFP recognition by mouse Qrfpr?

Recent cryo-electron microscopy studies have revealed the structure of the QRFP26-GPR103-Gq complex at 3.19 Å resolution. QRFP26 adopts an extended structure without secondary structure elements, with its N-terminal and C-terminal sides recognized by different domains of the receptor .

The interaction can be characterized by:

  • The N-terminal portion of QRFP26 interacts with the extracellular domain of GPR103/Qrfpr.

  • The C-terminal portion, including the critical RF-amide motif, interacts with the transmembrane domain of the receptor.

  • This binding mode is reminiscent of class B1 GPCRs, but with differences in the orientation and structure of the ligand .

This unique assembly mode is critical for high-affinity binding and receptor specificity. The recognition mechanism of the C-terminal heptapeptide of 26RFa by the transmembrane binding pocket of Qrfpr is particularly important for receptor activation .

How does mouse Qrfpr compare to other RF-amide peptide receptors?

Mouse Qrfpr belongs to the RF-amide peptide receptor family, which includes five distinct receptors in mammals:

ReceptorAlternative NamesEndogenous LigandsPrimary Functions
QrfprGPR103QRFP (26RFa, 43RFa)Energy homeostasis, appetite regulation, bone formation
NPFF1RGPR147NPFF, RFRP/NPVFPain modulation, reproduction
NPFF2RGPR74NPFFPain modulation, cardiovascular regulation
PrRPRGPR10PrRPStress response, energy balance
KISS1RGPR54KisspeptinReproduction, puberty onset

Structural comparisons with closely related receptors, including other RF-amide peptide-recognizing GPCRs, have revealed both conserved and diversified peptide recognition mechanisms . The RF-amide motif interaction with the receptors shows similarities, while other regions of the peptides and receptors contribute to specificity and differential signaling properties .

What phenotypes are observed in mouse models with Qrfpr mutations?

Mice with homozygous mutations in the Qrfpr gene display several phenotypic abnormalities, particularly affecting the skeletal system:

  • Kyphosis: Abnormal outward curvature of the spine, creating a "hunched" appearance.

  • Abnormal vertebrae morphology: Structural changes in the vertebrae.

  • Developmental abnormalities: Altered developmental patterns in the vertebral column.

  • Osteopenia: Reduced bone mineral density specifically observed in the vertebrae .

These skeletal phenotypes suggest that Qrfpr plays a crucial role in bone development and homeostasis, which is distinct from but may be related to its better-known functions in energy metabolism and appetite regulation .

What are the recommended techniques for expressing and purifying recombinant mouse Qrfpr?

For expressing and purifying recombinant mouse Qrfpr, the following methodological approach is recommended:

  • Expression System Selection:

    • Mammalian expression systems (HEK293 or CHO cells) are generally preferred for GPCRs to ensure proper folding and post-translational modifications.

    • Insect cell systems (Sf9 or Hi5) can also be used for higher expression yields, especially when combined with a baculovirus expression vector system.

  • Construct Design:

    • Include an N-terminal signal peptide to ensure proper membrane insertion.

    • Add affinity tags (e.g., His6, FLAG, or STREP) for purification.

    • Consider fusion partners (e.g., T4 lysozyme or thermostabilized apocytochrome b562) to enhance stability and crystallizability for structural studies.

    • The full sequence of human QRFPR (431 amino acids) can serve as a reference for construct design .

  • Solubilization and Purification:

    • Use mild detergents (DDM, LMNG, or GDN) for membrane extraction.

    • Employ affinity chromatography followed by size-exclusion chromatography.

    • Consider lipid supplementation during purification to maintain protein stability.

  • Quality Control:

    • Assess receptor homogeneity using SDS-PAGE and size-exclusion chromatography.

    • Verify functionality through ligand binding assays using labeled QRFP peptides.

    • Thermal stability assays can evaluate the integrity of the purified receptor.

These methodologies have been successfully applied in recent structural studies of QRFP-receptor complexes .

What functional assays are most appropriate for studying mouse Qrfpr activation?

Several functional assays can be employed to study mouse Qrfpr activation, each providing different insights into receptor function:

  • G Protein Coupling Assays:

    • Calcium Mobilization: Since Qrfpr couples to Gq proteins, calcium flux assays using fluorescent indicators (Fluo-4, Fura-2) are effective for measuring receptor activation .

    • cAMP Assays: To measure Gi/o coupling, researchers can quantify the inhibition of forskolin-stimulated cAMP production using FRET- or luminescence-based approaches.

    • [35S]GTPγS Binding: This assay directly measures G protein activation and can distinguish between different G protein subtypes.

  • β-Arrestin Recruitment Assays:

    • BRET or FRET-based assays to measure the recruitment of β-arrestins following receptor activation.

    • These assays can reveal biased signaling properties of different ligands.

  • Receptor Internalization:

    • Fluorescently-labeled antibodies or receptors can be used to track internalization via microscopy or flow cytometry.

    • This provides insights into receptor desensitization mechanisms.

  • Physiological Readouts:

    • Food Intake Measurements: Given Qrfpr's role in appetite regulation, food consumption can be measured following administration of receptor agonists or antagonists .

    • Hormone Release Assays: Measuring aldosterone release in response to QRFP administration can assess receptor function in adrenal tissues .

How can researchers generate reliable mouse models for studying Qrfpr function?

Creating reliable mouse models for studying Qrfpr function requires careful consideration of the genetic approach and validation methods:

  • Genetic Approaches:

    • Global Knockout: Complete deletion of the Qrfpr gene to study systemic effects.

    • Conditional Knockout: Using Cre-loxP system to delete Qrfpr in specific tissues or at specific developmental stages.

    • Knockin Models: Introducing specific mutations to study structure-function relationships or to tag the receptor for visualization.

    • Transgenic Overexpression: Overexpressing wild-type or mutant Qrfpr to study gain-of-function effects.

  • Validation Strategies:

    • Genotyping: PCR-based verification of the genetic modification.

    • Expression Analysis: qRT-PCR, Western blotting, and immunohistochemistry to confirm altered expression patterns.

    • Functional Validation: Testing receptor responses to known ligands in primary cells or tissues.

    • Phenotypic Characterization: Comprehensive assessment of phenotypes, particularly focusing on:

      • Skeletal development and bone density (μCT analysis)

      • Feeding behavior and energy expenditure measurements

      • Hormone levels (particularly those affected by Qrfpr signaling)

  • Control Considerations:

    • Use littermate controls whenever possible to minimize genetic background effects.

    • Consider complementation tests by reintroducing wild-type Qrfpr to confirm phenotypes are due to Qrfpr deficiency.

In existing models, mice homozygous for Qrfpr mutations display kyphosis and vertebral abnormalities, providing important skeletal phenotypes that can be used as markers for successful model generation .

What is the potential of Qrfpr as a therapeutic target for metabolic disorders?

Qrfpr represents a promising therapeutic target for metabolic disorders based on its involvement in energy homeostasis and appetite regulation:

  • Obesity Treatment:

    • Qrfpr antagonists could potentially reduce food intake and increase energy expenditure, offering a novel approach for obesity management .

    • The receptor's role in adipogenesis regulation suggests that targeting Qrfpr might also affect fat storage and distribution .

  • Diabetes Management:

    • The metabolic effects of Qrfpr modulation could extend to improvements in glucose homeostasis and insulin sensitivity.

    • Research into the cross-talk between Qrfpr signaling and other metabolic pathways may reveal additional therapeutic opportunities .

  • Eating Disorders:

    • Understanding the central nervous system circuits where Qrfpr operates could provide insights for treating both hyperphagia and hypophagia conditions .

  • Precision Medicine Approaches:

    • Genetic variations in the Qrfpr gene might predict individual responses to weight management interventions.

    • Developing Qrfpr modulators that selectively target specific signaling pathways could minimize side effects while maximizing therapeutic benefits.

The structural insights gained from recent studies of the QRFP-Qrfpr complex provide a foundation for rational drug design efforts targeting this receptor .

How does the evolutionary conservation of Qrfpr inform our understanding of its function?

The evolutionary conservation of Qrfpr across species offers valuable insights into its fundamental biological functions:

  • Vertebrate Conservation:

    • The QRFP/Qrfpr system has been identified in various vertebrates, including humans, rats, mice, birds, and fish, suggesting core functions that have been conserved throughout vertebrate evolution .

    • The amino acid sequences of 26RFa are highly conserved among mammalian species, with rat 26RFa being slightly more potent than human 26RFa in functional assays .

  • Recent Invertebrate Discoveries:

    • The identification of QRFP-like peptide receptors in non-chordates, such as the cephalopod Sepiella japonica, represents a significant evolutionary finding .

    • These discoveries suggest that the QRFP/Qrfpr system predates the divergence of vertebrates and may have ancient origins in the common ancestors of bilaterians.

  • Functional Conservation:

    • The role of QRFP-like peptide receptors in stimulating food intake appears to be conserved between cephalopods and vertebrates, indicating a fundamental function in regulating energy homeostasis across diverse animal phyla .

    • The potential link between QRFP-like receptors and immune response in cephalopods suggests additional ancestral functions that may still be relevant in mammals .

  • Structural Conservation:

    • QRFPR is likely to be structurally conserved in cephalopod species, suggesting that the basic molecular mechanisms of ligand recognition and receptor activation have been maintained throughout evolution .

    • Comparative studies of receptor structures across species could reveal the essential components required for function versus those that represent species-specific adaptations.

Understanding this evolutionary conservation not only informs basic biology but also helps predict which aspects of Qrfpr function might be most relevant for translational research.

What is the interplay between Qrfpr and other RF-amide peptide receptors in physiological regulation?

The interaction between Qrfpr and other RF-amide peptide receptors creates a complex regulatory network affecting multiple physiological systems:

  • Shared Ligand Recognition:

    • All RF-amide peptide receptors recognize ligands with the conserved C-terminal RF-amide motif, though with different affinities and specificities .

    • Structural comparisons have revealed both conserved and diversified peptide recognition mechanisms, providing insights into how selectivity is achieved despite similar binding motifs .

  • Overlapping Expression Patterns:

    • RF-amide peptide receptors often show overlapping expression in certain brain regions, particularly those involved in energy homeostasis and neuroendocrine function.

    • This co-expression suggests potential for coordinated or compensatory regulation.

  • Functional Cooperation and Competition:

    • Different RF-amide systems may work together or antagonistically to fine-tune physiological responses.

    • For example, while Qrfpr activation generally promotes feeding, other RF-amide receptors like NPFF receptors can have anorexigenic effects, creating a balanced regulatory system .

  • Signaling Crosstalk:

    • RF-amide receptors can couple to similar G proteins, potentially leading to convergent or divergent signaling depending on the cellular context.

    • This signaling crosstalk may explain why RF-amide peptides have such diverse physiological effects ranging from feeding behavior to reproduction and pain modulation .

Understanding this interplay is crucial for developing targeted therapeutics that modulate specific aspects of RF-amide signaling without disrupting the entire regulatory network.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.