Recombinant Mouse Radiation-inducible immediate-early gene IEX-1 (Ier3)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Cellular Processes

IER3 acts as a bifunctional regulator depending on cellular context:

Apoptosis Regulation

  • Pro-apoptotic Role: Enhances Fas/TNF-α-induced apoptosis by suppressing NF-κB and BCL-2 family proteins (e.g., BCL-xL, MCL-1) .

  • Anti-apoptotic Role: Inhibits ERK dephosphorylation via PP2A-PPP2R5C, promoting survival under stress .

Cell Cycle Control

  • Accelerates G1/S transition by stabilizing E2F1 and cyclin D1 .

  • Deficiency reduces hematopoietic stem cell proliferation and causes thrombocytopenia in mice .

Stress Response

  • Rapidly induced by ionizing radiation, oxidative stress, and cytokines (e.g., TNF-α) .

  • Regulates mitochondrial F1Fo-ATP synthase activity, influencing cellular energy metabolism .

3.1. Cancer Biology

  • Myelodysplastic Syndromes (MDS):

    • IER3 rearrangements or amplifications occur in 4–5% of MDS cases, correlating with altered apoptosis and disease progression .

    • Dysregulated expression (61% of MDS patients) associates with NF-κB pathway dysfunction .

  • Cervical Cancer:

    • IER3 mediates TAp73β-induced apoptosis via BIM activation, enhancing chemosensitivity .

3.2. Cardiovascular Disease

  • Heart Failure:

    • Blunted IER3 expression in titin-deficient mice increases cardiomyocyte apoptosis under angiotensin II stress .

    • IER3 targets anti-apoptotic gene promoters (e.g., BCL2), acting as a cardioprotective factor .

3.3. Immunology

  • Ier3−/− mice exhibit aberrant T-cell activation, systemic inflammation, and hypertension due to dysregulated ERK/NF-κB signaling .

Experimental Validation

Recombinant IEX-1/IER3 is validated using:

  • Western Blot: Detected at 68 kDa in mouse skin lysates .

  • Immunohistochemistry: Localized to nuclei in human liver and brain tissues .

  • Functional Assays:

    • Apoptosis rescue in Ier3−/− hematopoietic stem cells restores platelet production .

    • Overexpression in HL-1 cardiomyocytes reduces apoptosis under heat shock or doxazosin stress .

Research Implications

  • Therapeutic Target: Modulating IER3 expression could improve outcomes in MDS or heart failure .

  • Biomarker Potential: IER3 expression levels may predict apoptosis sensitivity in cancer therapy .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate any specific format requirements. Please indicate your preference in the order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timelines, kindly consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Ier3; Gly96; Iex1; Radiation-inducible immediate-early gene IEX-1; Immediate early protein GLY96; Immediate early response 3 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MCHSRNHLHTMTGLRAPSPAPSTGPELRRGSGPEIFTFDPLPERAVVSTARLNTSRGHRKRSRRVLYPRVVRRQLPTEEPNIAKRVLFLLFAIIFCQILMAEEGVSQPLAPEDATSAVTPEPISAPITAPPVLEPLNLTSESSDYALDLKAFLQQHPAAF
Uniprot No.

Target Background

Function
This protein may play a role in the ERK signaling pathway by inhibiting the dephosphorylation of ERK by phosphatase PP2A-PPP2R5C holoenzyme. It also functions as an ERK downstream effector, mediating survival. As a member of the NUPR1/RELB/IER3 survival pathway, it may contribute to the development of pancreatic intraepithelial neoplasias.
Database Links
Protein Families
IER3 family
Subcellular Location
Membrane; Single-pass type II membrane protein.
Tissue Specificity
Expressed predominantly in the lung, testes and the uterus.

Q&A

What is the molecular characterization of mouse IEX-1 (Ier3) protein?

IEX-1 (Immediate Early Response 3, Ier3) is a radiation-inducible immediate-early gene that functions as an early response and NF-κB target gene. The protein is encoded in the genome of mouse and has several synonyms including Immediate early protein GLY96 and Immediate early response 3 protein . As a substrate for Extracellular signal-Regulated Kinases (ERKs), IEX-1 plays a critical role in cellular viability regulation and stress response mechanisms . The protein contains specific ERK phosphoacceptor sites and ERK docking domains that are essential for its function in survival pathways .

How does IEX-1 expression change in response to cellular stress?

IEX-1 expression is rapidly induced in response to various cellular stressors, functioning as an immediate-early gene. Research has demonstrated that IEX-1 is upregulated following:

  • X-irradiation and UV radiation exposure

  • Growth factor stimulation

  • NF-κB pathway activation

Studies have shown that IEX-1 is regulated by X-irradiation, UV radiation, and various growth factors, with its expression being controlled through NF-κB-dependent mechanisms . This stress-responsive nature positions IEX-1 as a critical mediator in cellular adaptation to environmental challenges and stress conditions.

How does IEX-1 interact with the ERK signaling pathway?

IEX-1 demonstrates a complex bidirectional relationship with the ERK signaling pathway:

  • As an ERK substrate: IEX-1 is phosphorylated by ERK1/2, which has been confirmed both in vitro and in vivo. Upon phosphorylation by ERKs, IEX-1 acquires anti-apoptotic properties that inhibit cell death induced by various stimuli .

  • As an ERK regulator: IEX-1 potentiates ERK activation in response to various growth factors. Experimental data shows that cells transfected with wild-type IEX-1 demonstrate significantly increased ERK phosphorylation and kinase activity compared to control cells . In seven independent experiments, IEX-1 increased ERK activity by 20 ± 14-fold (mean ± SE) .

  • Mechanism of action: IEX-1 may inhibit the dephosphorylation of ERK by phosphatase PP2A-PPP2R5C holoenzyme, thereby maintaining ERK in its active form .

This dual functionality positions IEX-1 as both a downstream effector and an upstream modulator of ERK signaling.

What is the relationship between IEX-1 phosphorylation and its anti-apoptotic function?

IEX-1's pro-survival effect is directly dependent on its phosphorylation state but independent of its ability to potentiate ERK activation. Studies using IEX-1 mutants with altered ERK phosphoacceptor and/or ERK docking sites have demonstrated this relationship . The data indicates that:

  • Phosphorylation of IEX-1 by ERK is necessary for its anti-apoptotic properties

  • The ability of IEX-1 to enhance ERK activation is not required for its pro-survival function

  • IEX-1-induced modulation of ERK activation requires ERK-IEX-1 association but is independent of IEX-1 phosphorylation

This suggests distinct molecular mechanisms for the dual functions of IEX-1 in cell survival and ERK regulation.

What are the optimal methods for studying IEX-1 phosphorylation?

Researchers investigating IEX-1 phosphorylation should consider the following validated methodologies:

In vitro phosphorylation assay:

  • Express IEX-1 as a GST fusion protein and purify by glutathione-Sepharose chromatography

  • Incubate with purified active ERK2 in a kinase assay

  • Detect phosphorylation through incorporation of radioactive phosphate

In vivo phosphorylation detection:

  • Transfect cells with vectors encoding His-tagged IEX-1 and HA-ERK1

  • Examine ERK activation in anti-HA immunoprecipitates

  • Assess phosphorylation status using phospho-specific antibodies

For monitoring the effects of IEX-1 on ERK signaling, consider using Elk1-dependent transcription assays, as this has been shown to effectively detect IEX-1-induced stimulation of endogenous ERK activity .

How can researchers effectively express and purify recombinant mouse IEX-1 protein?

Based on established protocols, the following approach is recommended for recombinant IEX-1 expression and purification:

  • Expression system selection: The IEX-1 coding region can be effectively expressed as a GST fusion protein in E. coli systems .

  • Purification protocol:

    • Transform expression vector into an appropriate E. coli strain

    • Induce protein expression with IPTG

    • Lyse cells under native conditions

    • Purify using glutathione-Sepharose chromatography

    • Verify protein purity by SDS-PAGE

  • Functional validation: Confirm biological activity of purified protein through:

    • In vitro kinase assays with active ERK2

    • Binding assays with phosphorylated ERK

    • Cell-based survival assays following various death stimuli

This approach has been successfully employed in previous studies investigating IEX-1 phosphorylation and function .

What is the role of IEX-1/IER3 in acute myeloid leukemia (AML) progression?

Recent research has established IER3 (IEX-1) as a significant factor in AML pathogenesis. Bioinformatics analysis of TCGA and GEO databases revealed that high IER3 expression correlates with significantly worse prognosis in AML patients . Functional studies have demonstrated that IER3:

  • Enhances proliferation: CCK-8 assays showed that IER3 enhances the proliferation ability of AML cells .

  • Promotes cell cycle progression: Cell cycle analysis demonstrated that IER3 promotes HL60 cells to enter the S phase of DNA synthesis from the quiescent phase and stimulates HEL cells to enter mitosis .

  • Increases clonogenic ability: Clone-formation experiments suggested that IER3 enhanced the clonogenic capacity of AML cells .

  • Promotes tumorigenesis: In vivo studies confirmed that IER3 promotes the tumorigenesis of AML .

  • Induces autophagy: IER3 was found to promote autophagy in AML cells through negative regulation of the AKT/mTOR pathway .

These findings position IER3 as a potential therapeutic target in AML treatment strategies.

How does IEX-1 contribute to autophagy regulation in cancer cells?

IER3 (IEX-1) has been identified as a critical regulator of autophagy in cancer cells, particularly in AML. The mechanism involves:

  • Negative regulation of AKT/mTOR pathway: IER3 was found to negatively regulate the phosphorylation and activation of the AKT/mTOR pathway, which is a key inhibitor of autophagy .

  • Molecular pathway: Experimental investigation revealed that IER3 promotes autophagy by specifically targeting the phosphorylation-dependent activation of AKT/mTOR signaling components .

  • Transcriptional regulation: SATB1 (Special AT-rich sequence binding protein 1) was found to bind to the promoter region of IER3 gene and negatively regulate its transcription, suggesting a complex regulatory network controlling IER3-mediated autophagy .

This autophagy-promoting function of IER3 represents a novel mechanism by which this gene contributes to cancer progression and potentially treatment resistance.

What are the key considerations for interpreting conflicting data regarding IEX-1 function?

Researchers studying IEX-1 should be aware of several factors that may contribute to apparently contradictory findings:

  • Cell type-specific effects: IEX-1 has been reported to have both pro-survival and pro-apoptotic functions depending on the cellular context. This variability may be related to differential expression of interacting partners or regulatory proteins across cell types .

  • Activation status of ERK pathway: Since IEX-1 function is intimately linked to ERK signaling, the baseline activation state of this pathway in experimental systems may influence observed outcomes .

  • Expression levels: Overexpression versus physiological expression levels may yield different functional consequences.

  • Post-translational modifications: The phosphorylation status of IEX-1 critically determines its function, and variation in kinase activity across experimental systems may lead to different results .

  • Data source inconsistencies: As seen in financial data comparisons between different platforms, biological data can also show variations between sources that require careful validation .

When encountering contradictory data, researchers should carefully document experimental conditions, validate findings through multiple methodological approaches, and consider the specific cellular context being studied.

How can phosphoproteomic approaches enhance our understanding of IEX-1 function?

Phosphoproteomic analysis represents a powerful approach for elucidating IEX-1 function and regulation:

  • Identification of phosphorylation sites: Unbiased label-free quantitative phosphoproteomics can identify novel phosphorylation sites on IEX-1 beyond the known ERK-targeted residues .

  • Pathway analysis: Phosphoproteomic studies have revealed that IER3 negatively regulates the AKT/mTOR pathway, providing insights into its role in autophagy and cancer progression .

  • Temporal dynamics: Phosphoproteomic approaches can track the kinetics of IEX-1 phosphorylation and downstream signaling events following various stimuli.

  • Integration with other 'omics' data: Combining phosphoproteomics with transcriptomics and proteomics can provide a more comprehensive understanding of IEX-1 function in complex cellular networks.

Researchers employing these approaches should consider experimental design factors such as appropriate controls, temporal sampling points, and validation of mass spectrometry findings through orthogonal methods.

What strategies can overcome difficulties in detecting endogenous IEX-1 protein?

Detection of endogenous IEX-1 protein can be challenging due to its low basal expression and rapid turnover. Researchers can employ the following strategies:

  • Stimulus-induced expression: Treat cells with known inducers of IEX-1 expression such as radiation, growth factors, or NF-κB activators prior to analysis .

  • Enrichment techniques:

    • Immunoprecipitation with validated antibodies

    • Phosphorylation-dependent enrichment for activated IEX-1

    • Subcellular fractionation to concentrate samples

  • Sensitive detection methods:

    • Enhanced chemiluminescence with extended exposure times

    • Fluorescence-based Western blotting

    • Mass spectrometry targeted approaches

  • Genetic approaches: Use of CRISPR/Cas9 to add epitope tags to endogenous IEX-1 can facilitate detection while maintaining physiological expression levels.

These approaches have been successfully employed in studies investigating endogenous IEX-1 functions in various cellular contexts.

How can researchers address data inconsistencies when studying IEX-1 across different experimental platforms?

When encountering data inconsistencies, researchers should implement a systematic approach:

  • Source validation: Similar to financial data discrepancies between platforms like Yahoo Finance and IEX Cloud , biological data from different sources may show variations. Researchers should validate findings using multiple, independent data sources.

  • Standardization protocols:

    • Use consistent cell lines, passage numbers, and culture conditions

    • Standardize protein extraction and analysis methods

    • Employ the same antibodies and detection systems across experiments

  • Cross-validation strategies:

    • Verify findings using multiple methodological approaches

    • Implement both in vitro and in vivo systems when possible

    • Utilize both gain-of-function and loss-of-function approaches

  • Statistical considerations:

    • Account for biological variability through appropriate sample sizes

    • Apply robust statistical methods suitable for the data type

    • Consider meta-analysis approaches when integrating data from multiple sources

By implementing these strategies, researchers can strengthen the reliability and reproducibility of their findings related to IEX-1 function and regulation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.