Recombinant Mouse Receptor expression-enhancing protein 1 (Reep1)

Shipped with Ice Packs
In Stock

Description

General Information

Receptor Expression-Enhancing Protein 1 (REEP1) is a protein that, in humans, is encoded by the REEP1 gene . REEP1 belongs to a family of six REEP proteins (REEP1-6) that can enhance the expression of olfactory receptors and other G protein-coupled receptors (GPCRs) that are difficult to express . REEP1 is associated with hereditary spastic paraplegia type 31 (SPG31), a neurological disorder .

Gene and Protein Structure

The REEP1 gene contains a highly conserved microRNA binding site in the 3' UTR, and mutations in this region can affect its post-transcriptional regulation . The REEP1 protein includes a conserved TB2/DP1/HVA22 domain that may function as a chaperone . It also has a mitochondrial localization domain and a cytoplasmic C-terminus that interacts with microtubules .

Expression and Localization

REEP1 protein expression is restricted to neuronal tissues, such as the brain and spinal cord, and testes . It is also found in tissues that exhibit neuronal-like exocytosis, such as the pituitary and adrenal gland . Within cells, REEP1 localizes to numerous punctate structures dispersed throughout the cytoplasm, often in close proximity to the endoplasmic reticulum (ER) . These punctate structures represent a distinct membrane compartment .

Function

REEP1 participates in the functional activities of organelles, such as the interaction between the tubular ER and microtubules, and in shaping the peripheral ER . It may modulate specific G protein-coupled receptor trafficking by affecting ER cargo capacity .

Role in Disease

Mutations in the REEP1 gene are linked to neurodegenerative disorders, including hereditary spastic paraplegia (HSP) and distal hereditary motor neuropathy type V (dHMN-V) . Approximately 60 pathogenic mutations in REEP1 have been reported, including missense mutations, non-sense mutations, exon deletions, splicing site mutations, and microRNA binding site mutations . Many missense mutations are located near the N terminus, a hotspot region that influences REEP1 localization in the ER .

Disruption of the hairpin domain harms ER organization in distal axons, which may explain the length-dependent degeneration of upper motor neurons in HSP .

Research Findings

FindingDescriptionReference
REEP1 LocalizationREEP1 localizes to numerous punctate structures dispersed throughout the cytoplasm.
REEP1 and ER AssociationREEP1 punctae are often in close proximity to the ER, but a significant portion does not overlap with the ER.
REEP1 Expression SpecificityREEP1 protein expression is restricted to neuronal tissues (brain, spinal cord) and testes.
Functional Studies in REEP1 Mutated CellsMutant fibroblasts showed reduced accumulation of tetramethylrhodamine methyl ester (TMRM), indicating mitochondrial dysfunction. Mutant cells maintained their mitochondrial membrane potential (ΔΨm) after the addition of oligomycin, an inhibitor of mitochondrial F1FO-ATP synthase.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Specify your required tag type for preferential development.
Synonyms
Reep1; D6Ertd253e; Receptor expression-enhancing protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-201
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Reep1
Target Protein Sequence
MVSWIISRLVVLIFGTLYPAYYSYKAVKSKDIKEYVKWMMYWIIFALFTTAETFTDIFLC WFPFYYELKIAFVAWLLSPYTKGSSLLYRKFVHPTLSSKEKEIDDCLVQAKDRSYDALVH FGKRGLNVAATAAVMAASKGQGALSERLRSFSMQDLTTIRGDGAPAPSGPPPPGTGRSSG KHSQPKMSRSASESAGSSGTA
Uniprot No.

Target Background

Function
REEP1 is essential for endoplasmic reticulum (ER) network formation, shaping, and remodeling. It connects ER tubules to the cytoskeleton and may enhance cell surface expression of odorant receptors.
Gene References Into Functions
  1. REEP1 co-immunoprecipitates with seipin, strengthening the link between altered reticulum morphogenesis, lipid abnormalities, and the pathogenesis of common Hereditary spastic paraplegias. PMID: 27638887
  2. Functional mutation analysis reveals distinct pathomechanisms associated with REEP1 mutations, illuminating its functions. PMID: 24478229
Database Links
Protein Families
DP1 family
Subcellular Location
Membrane. Mitochondrion membrane; Multi-pass membrane protein. Endoplasmic reticulum.
Tissue Specificity
Detected in olfactory sensory neurons of the olfactory epithelium, and in total brain.

Q&A

What is REEP1 and what is its primary cellular function?

REEP1 (Receptor expression-enhancing protein 1) is a neuron-specific, membrane-binding protein that resides in the endoplasmic reticulum (ER). It functions as a membrane curvature-inducing protein critical for maintaining proper ER architecture, particularly in neurons with long axons. REEP1 plays an essential role in shaping the peripheral ER and is connected to long-term axon survival . Mutations in the REEP1 gene are associated with hereditary spastic paraplegia (HSP), specifically the autosomal dominantly inherited variant SPG31. As part of the larger REEP family, these proteins may be involved in regulating the proper expression and function of various G-protein coupled receptors (GPCRs) and other membrane proteins .

How does REEP1 differ from other members of the REEP family?

While all members of the REEP family are involved in ER membrane shaping and protein expression, REEP1 stands out for its strong association with neurological disorders, particularly hereditary spastic paraplegia. Unlike some REEP proteins that are broadly expressed, REEP1 shows prominent expression in cortical motor neurons . Functionally, REEP1 appears to have specific interactions with certain receptors; for example, research has shown that while REEP5 and REEP6 co-precipitate with CXCR1 but not CXCR2, REEP proteins demonstrate selectivity in their receptor interactions . This selectivity suggests that different REEP family members may have specialized roles in different cell types or with different receptor classes.

What are the structural characteristics of mouse REEP1?

Mouse REEP1 is a membrane protein that contains hydrophobic regions allowing it to bind to and integrate into the ER membrane. Its structure enables it to induce positive membrane curvature, which is critical for proper ER shaping, particularly in the peripheral ER of neurons. The research on REEP1-deficient mice has shown that the loss of this protein leads to reduced complexity of the peripheral ER in cortical motor neurons upon ultrastructural analysis . This suggests that REEP1 contains structural domains essential for membrane modeling and maintenance of the ER architecture, particularly in neurons with high demands for proper ER distribution.

How can I develop a mouse model to study REEP1-related diseases?

To establish a valid mouse model for REEP1-related diseases such as HSP SPG31, you can employ gene editing approaches to generate heterozygous or homozygous deletions in the Reep1 gene. Based on published research, a particularly effective approach has been the deletion of exon 2 in Reep1, which replicates a mutation identified in human patients . To create this model:

  • Design guide RNAs targeting sequences flanking exon 2 of the Reep1 gene

  • Introduce these constructs into mouse embryonic stem cells or zygotes using CRISPR/Cas9 technology

  • Screen for successful deletions through genotyping

  • Establish breeding colonies of heterozygous mice (Reep1+/−)

  • Produce experimental cohorts of wild-type (Reep1+/+), heterozygous (Reep1+/−), and homozygous (Reep1−/−) mice through controlled breeding

This model has been validated to produce phenotypes closely resembling those in human HSP patients, with heterozygous mice showing later onset and milder impairment compared to homozygous knockouts, which display more severe phenotypes with earlier onset .

What phenotypic assessments are most informative when studying REEP1-deficient mice?

When evaluating REEP1-deficient mice, the following assessments provide the most valuable insights into disease progression and severity:

  • Gait analysis: Measure the foot-base angle over time to quantify the progression of movement impairment. In published models, significant decreases were first observed in 16-week-old Reep1−/− mice, with heterozygous animals showing later onset but eventual strong impairments by 20 weeks of age .

  • Motor function tests: Document abnormal hind limb abduction, external rotation of paws, and simultaneous forward movements of both hind limbs during locomotion. Skilled walking challenges, such as climbing an inclined ladder, can reveal spastic clonus .

  • Histological examination: Perform cross-sections of the spinal cord at lumbar levels to assess evidence of corticospinal tract axon degeneration, which becomes apparent in 30-week-old Reep1−/− mice .

  • Electrophysiological measurements: Measure compound muscle action potentials (CMAPs) in muscles such as the musculus triceps surae to evaluate lower motor neuron involvement .

  • Ultrastructural analysis: Examine the complexity of peripheral ER in cortical motor neurons using electron microscopy to directly assess the cellular pathology resulting from REEP1 deficiency .

These assessments collectively provide a comprehensive evaluation of the neurological and motor impairments characteristic of REEP1-related disorders.

How do heterozygous and homozygous REEP1 knockout models differ in their phenotypes?

Heterozygous (Reep1+/−) and homozygous (Reep1−/−) REEP1 knockout models exhibit different phenotypic severities, providing valuable insights into the dose-dependent effects of REEP1 deficiency:

Heterozygous (Reep1+/−) mice:

  • Later onset of symptoms compared to homozygous knockouts

  • Milder gait impairment initially, but eventually developing strong impairments

  • Phenotype closely resembles the autosomal dominant inheritance pattern seen in human SPG31 patients

  • First detectable gait abnormalities typically appear after 16 weeks of age, becoming pronounced by 20 weeks

Homozygous (Reep1−/−) mice:

  • Earlier onset of symptoms

  • More severe phenotype with pronounced gait abnormalities

  • Complete loss of REEP1 protein

  • Significant decrease in foot-base angle first observed at 16 weeks of age

  • Evidence of corticospinal tract axon degeneration visible in spinal cord cross-sections by 30 weeks

Both models show sparing of cortical motor neuron somata even at advanced ages (13 months), suggesting that REEP1 deficiency primarily affects axon survival rather than causing neuronal death . This differential severity pattern confirms a REEP1 dose-dependent pathology that closely mimics human HSP conditions.

How does REEP1 affect endoplasmic reticulum structure and function?

REEP1 plays a critical role in maintaining proper endoplasmic reticulum (ER) architecture, particularly in neurons with long axons. Through its membrane-binding and curvature-inducing properties, REEP1:

  • Increases the complexity of the peripheral ER network, which is essential for proper neuronal function

  • Contributes to the formation of tubular ER structures through its membrane curvature-inducing activity

  • Supports the extension of the ER network into neuronal processes, including axons

In REEP1-deficient mice, cortical motor neurons show reduced complexity of the peripheral ER upon ultrastructural analysis . This structural alteration appears to be directly connected to the failure in maintaining long axons, suggesting that proper ER distribution throughout the neuron is critical for axonal integrity. The specific mechanism likely involves REEP1's ability to induce positive membrane curvature, which shapes the ER tubules and allows them to extend into peripheral cellular regions. Without this function, neurons with particularly long axons (such as cortical motor neurons) cannot maintain proper ER distribution, ultimately leading to axonal degeneration .

What methods are most effective for detecting REEP1 expression in tissue samples?

For effective detection of REEP1 expression in tissue samples, researchers should consider the following complementary approaches:

  • RT-PCR analysis: This method can identify REEP1 transcripts in various tissues and cell types. RT-PCR has been successfully used to detect endogenous expression of REEP family members, including REEP1, in cell lines such as HEK293 . When designing primers, target conserved regions to ensure reliable amplification.

  • Western blotting: For protein-level detection, western blotting using specific antibodies against REEP1 can reveal expression patterns. Be aware that membrane proteins like REEP1 may require specialized extraction buffers containing detergents for efficient isolation.

  • Immunohistochemistry/Immunofluorescence: These techniques allow for visualization of REEP1 distribution within tissues and cells. They are particularly valuable for confirming the neuron-specific expression pattern of REEP1 and its localization to the ER.

  • In situ hybridization: This approach can map REEP1 mRNA expression across different regions of tissues such as brain and spinal cord, helping to identify specific neuronal populations expressing REEP1.

When interpreting results, it's important to note that REEP1 expression is particularly prominent in cortical motor neurons , making these cells an important positive control in expression studies.

What is the role of REEP1 in receptor trafficking and function?

While REEP1's primary function appears to be in ER membrane shaping, studies on related REEP family members provide insights into potential roles in receptor trafficking and function:

  • Receptor endocytosis: REEPs might be involved in ligand-stimulated endocytosis of certain receptors. For example, in the absence of REEP5 and REEP6, receptor internalization and intracellular clustering of β-arrestin2 following ligand treatment were impaired for CXCR1 .

  • Signal transduction enhancement: Some REEP proteins enhance ligand-stimulated cellular responses. Overexpression of REEP5 and REEP6 enhanced IL-8-stimulated cellular responses through CXCR1, whereas depletion led to downregulation of the responses .

  • Selective receptor interactions: REEPs appear to interact selectively with certain receptors. Co-immunoprecipitation experiments have shown that some REEPs co-precipitate with specific receptors (e.g., CXCR1) but not others (e.g., CXCR2) .

Although most research on receptor interactions has focused on other REEP family members, REEP1 may share some of these functions, particularly in neuronal contexts where it is predominantly expressed. The specific receptors that interact with REEP1 in neurons and how these interactions contribute to neuron-specific functions remain areas for further investigation.

How can I differentiate between direct and indirect effects of REEP1 deficiency in experimental models?

Differentiating between direct and indirect effects of REEP1 deficiency requires a multi-faceted experimental approach:

  • Temporal analysis: Monitor phenotypic progression over time to establish the sequence of molecular and cellular changes. In REEP1-deficient mice, gait impairment progresses with age, with axonal degeneration in the spinal cord observed at later stages . Earlier molecular changes are more likely to represent direct effects of REEP1 loss.

  • Cell-specific rescue experiments: Reintroduce wild-type REEP1 specifically into cortical motor neurons of REEP1-deficient mice using neuron-specific promoters. If the phenotype improves, this suggests a direct cell-autonomous effect of REEP1 in these neurons.

  • In vitro studies with isolated neurons: Compare ER morphology and function in isolated cortical neurons from wild-type and REEP1-deficient mice. Direct effects should be observable in culture, separate from secondary effects that might arise from circuit-level changes in vivo.

  • Acute manipulation studies: Use inducible knockdown systems to acutely reduce REEP1 levels in adult animals or mature neurons. This helps distinguish developmental effects from acute physiological requirements for REEP1.

  • Proteomic and interactomic analyses: Identify direct binding partners of REEP1 using techniques such as co-immunoprecipitation followed by mass spectrometry. Direct effects are more likely to involve these immediate interaction partners.

By integrating these approaches, researchers can build a causative model distinguishing primary cellular pathologies directly caused by REEP1 deficiency from secondary consequences that develop over time.

What are the potential mechanisms linking REEP1 dysfunction to axonal degeneration?

Several potential mechanisms may link REEP1 dysfunction to the axonal degeneration observed in hereditary spastic paraplegia:

  • Impaired ER distribution in axons: REEP1 deficiency leads to reduced complexity of the peripheral ER . In long axons of cortical motor neurons, this may result in inadequate ER distribution, compromising functions such as protein synthesis, calcium homeostasis, and lipid metabolism in distal axonal regions.

  • Disturbed membrane protein trafficking: As REEP proteins can enhance receptor function , REEP1 deficiency might impair the trafficking or function of key membrane proteins required for axonal maintenance or function.

  • Altered ER-mitochondria contact sites: Proper ER morphology is necessary for maintaining ER-mitochondria contact sites, which are critical for calcium signaling and lipid transfer. Disruption of these contacts due to altered ER morphology in REEP1-deficient neurons might compromise mitochondrial function in axons.

  • Compromised axonal transport: The ER network plays a role in organizing microtubules and potentially influencing axonal transport. REEP1 deficiency might indirectly affect the transport of organelles and proteins required for axonal maintenance.

  • ER stress responses: Alterations in ER morphology could trigger ER stress responses, including the unfolded protein response. Chronic ER stress has been linked to axonal degeneration in various neurodegenerative conditions.

Research in REEP1-deficient mice has shown that while there is axonal degeneration in the corticospinal tract, there is no loss of cortical motor neuron somata even at 13 months of age . This selective vulnerability of long axons supports the hypothesis that REEP1's role in maintaining proper ER architecture is particularly critical in cells with extensive processes.

How can REEP1 be utilized in therapeutic development for axonopathies?

REEP1 offers several potential avenues for therapeutic development targeting axonopathies, particularly hereditary spastic paraplegia:

  • Gene therapy approaches: Delivery of functional REEP1 genes specifically to affected neurons could restore proper ER morphology and function. Adeno-associated virus (AAV) vectors with neuronal tropism could be utilized for targeted delivery to cortical motor neurons.

  • Small molecule screening: Developing high-throughput screens to identify compounds that:

    • Stabilize mutant REEP1 protein

    • Enhance the function of remaining REEP1 in heterozygous conditions

    • Compensate for REEP1 deficiency by activating parallel pathways for ER shaping

  • Enhancement of other REEP family members: Upregulating the expression or function of other REEP family proteins (such as REEP5 or REEP6) could potentially compensate for REEP1 deficiency, as these proteins share some functional overlap in ER shaping.

  • ER-targeted approaches: Developing therapeutics that directly target ER morphology and function to bypass the requirement for REEP1, potentially through manipulation of other ER-shaping proteins.

  • Axonal protection strategies: Since the primary pathology appears to be axonal degeneration rather than neuronal death, neuroprotective approaches specifically targeting axon preservation might prove beneficial.

Research using cell and animal models suggests that even partial restoration of REEP1 function or compensation through alternative pathways could have therapeutic benefit, as heterozygous mice (Reep1+/−) show later onset and less severe phenotypes compared to homozygous knockouts . This indicates a potential therapeutic window where even modest interventions might significantly impact disease progression.

What are the optimal conditions for working with recombinant mouse REEP1 protein?

When working with recombinant mouse REEP1 protein, consider these optimal conditions to maintain protein stability and functionality:

When interpreting functional assays with recombinant REEP1, remember that as a membrane-shaping protein, its activity is highly dependent on proper membrane integration, which can be challenging to maintain in in vitro systems with purified proteins.

What controls should be included when studying REEP1 interactions with other proteins?

When investigating REEP1 interactions with other proteins, the following controls are essential to ensure reliable and interpretable results:

  • Negative interaction controls:

    • Include proteins known not to interact with REEP1, such as CXCR2, which has been shown not to co-precipitate with related REEP proteins despite sharing homology with CXCR1

    • Use truncated versions of REEP1 lacking key domains to demonstrate specificity of interactions

    • Include irrelevant proteins of similar size and cellular localization

  • Positive interaction controls:

    • Include known REEP1 binding partners if available

    • For novel screens, include other REEP family members (like REEP5 or REEP6) and their known interaction partners as system validation

  • Expression level controls:

    • Ensure comparable expression levels between experiments by Western blot quantification

    • Use multiple expression tags (N-terminal, C-terminal) to rule out tag interference with interactions

    • Include both overexpression and endogenous protein detection approaches

  • Reciprocal co-immunoprecipitation:

    • Perform pull-downs from both directions (immunoprecipitate REEP1 to detect partner, and immunoprecipitate partner to detect REEP1)

    • Verify interactions using multiple antibodies when possible

  • Cellular context controls:

    • Compare interactions in different cell types, particularly neuronal vs. non-neuronal cells

    • Include subcellular fractionation to confirm interaction location (e.g., ER membrane)

    • Use proximity ligation assays to confirm interactions occur in the expected cellular compartments

When analyzing co-immunoprecipitation results specifically, be aware that membrane proteins like REEP1 may show multiple bands on Western blots due to post-translational modifications such as glycosylation, similar to patterns observed with chemokine receptors .

How can I quantitatively assess ER morphology changes in REEP1 studies?

Quantitatively assessing ER morphology changes in REEP1 studies requires sophisticated imaging and analytical approaches:

  • Advanced microscopy techniques:

    • Transmission electron microscopy (TEM): Provides ultrastructural analysis of ER in REEP1-deficient neurons, allowing direct visualization of reduced complexity in the peripheral ER

    • Super-resolution microscopy: Techniques like STED, STORM, or PALM can reveal ER tubule dynamics and network complexity beyond diffraction limits

    • Live-cell imaging: Using ER-targeted fluorescent proteins to track dynamic changes in ER morphology in response to REEP1 manipulation

  • Quantitative parameters to measure:

    • ER tubule density: Number of tubules per unit area

    • Tubule branch points: Frequency of junctions in the ER network

    • Peripheral ER reach: Maximum distance of ER tubules from the cell center

    • Tubule persistence: Time-based measurements of tubule stability in live imaging

    • ER-plasma membrane contact sites: Frequency and extent of peripheral ER reaching the plasma membrane

  • Analytical approaches:

    • 3D reconstruction from serial EM sections to fully capture the complex architecture

    • Skeleton analysis of fluorescently labeled ER to quantify network complexity

    • Machine learning algorithms to automatically identify and measure ER features across large datasets

    • Fractal dimension analysis to quantify the complexity of the ER network

  • Experimental design considerations:

    • Compare multiple cell regions (soma vs. proximal axon vs. distal axon)

    • Include time-course analyses to detect progressive changes

    • Analyze multiple neurons across different animals to account for cell-to-cell variability

    • Include rescue experiments with wild-type REEP1 to confirm specificity of observed changes

This comprehensive quantitative assessment of ER morphology provides critical insights into how REEP1 deficiency affects neuronal ER architecture, particularly in the context of neurodegenerative diseases like hereditary spastic paraplegia where axon maintenance depends on proper ER distribution .

How do REEP1 mutations specifically lead to hereditary spastic paraplegia?

REEP1 mutations lead to hereditary spastic paraplegia (HSP) through several interconnected mechanisms:

  • Disruption of ER morphology: REEP1 mutations impair its ability to induce membrane curvature, resulting in reduced complexity of the peripheral ER in cortical motor neurons . This altered ER architecture is particularly detrimental to neurons with long axons, such as the corticospinal motor neurons affected in HSP.

  • Length-dependent axonopathy: The axons of cortical motor neurons extend the entire length of the spinal cord, making them particularly vulnerable to defects in ER distribution. Without proper REEP1 function, the ER network cannot be maintained throughout these exceptionally long axons. This explains why patients with REEP1 mutations (SPG31) typically show degeneration primarily in the longest axons in the central nervous system .

  • Preserved neuronal cell bodies: Studies in REEP1-deficient mice show that while axons degenerate, the cortical motor neuron cell bodies remain intact even at advanced ages (13 months) . This pattern of "dying back" axonopathy is characteristic of HSP and explains why the disease is potentially amenable to treatments that prevent axonal degeneration.

  • Dose-dependent effects: The severity and onset of symptoms correlate with REEP1 dosage. Heterozygous mice (modeling the dominant inheritance seen in human SPG31 patients) show later onset and milder symptoms compared to homozygous knockout mice . This dose-dependency provides insight into the variable expressivity seen in human patients with different REEP1 mutations.

  • Progressive nature: The gait impairment in REEP1-deficient mice progresses with age, mirroring the progressive nature of HSP in humans. Significant decrease in foot-base angle is first observed in 16-week-old Reep1−/− mice, with heterozygous animals showing later onset but eventually developing strong impairments .

This multi-faceted pathophysiology explains why REEP1 mutations specifically affect the corticospinal tract while sparing other neuronal populations, resulting in the characteristic upper motor neuron symptoms of HSP.

What are the comparative advantages of different REEP1 animal models?

Different REEP1 animal models offer distinct advantages for studying various aspects of REEP1 biology and related diseases:

1. Mouse Models with Exon 2 Deletion:

  • Advantages:

    • Closely recapitulate human SPG31 mutations

    • Show progressive gait disorder similar to human HSP

    • Allow study of both heterozygous and homozygous conditions

    • Enable detailed behavioral, electrophysiological, and histological analyses

    • Demonstrate dose-dependent phenotypes providing insight into disease mechanisms

  • Best for: Long-term disease progression studies, therapeutic testing, detailed behavioral analyses

2. Cell-Type Specific Conditional Knockouts:

  • Advantages:

    • Allow investigation of cell-autonomous effects of REEP1

    • Help distinguish between developmental versus adult requirements for REEP1

    • Enable tissue-specific phenotype analysis

  • Best for: Dissecting the contribution of different cell types to disease pathology

3. REEP1 Reporter Mouse Lines:

  • Advantages:

    • Enable precise mapping of REEP1 expression patterns

    • Allow visualization of subcellular localization in vivo

    • Facilitate cell isolation for downstream analyses

  • Best for: Developmental studies, cell type identification, live imaging

4. Drosophila Models:

  • Advantages:

    • Rapid generation time

    • Powerful genetic tools

    • Simplified nervous system

    • Conserved basic ER structure and function

  • Best for: High-throughput genetic interaction studies, initial drug screening

5. iPSC-Derived Models from Patient Cells:

  • Advantages:

    • Capture patient-specific genetic background

    • Allow study of human-specific aspects of disease

    • Enable personalized therapeutic approaches

  • Best for: Translational studies, human-specific disease mechanisms

When selecting a model, researchers should consider that the mouse models with heterozygous exon 2 deletion most faithfully reproduce the genetics and progressive nature of human SPG31, making them particularly valuable for therapeutic development .

What methodological approaches can detect subtle phenotypes in REEP1 models before obvious motor symptoms appear?

Detecting subtle phenotypes in REEP1 models before overt motor symptoms requires sensitive methodological approaches:

  • Advanced gait analysis systems:

    • Automated footprint analysis with high-speed cameras can detect subtle changes in stride length, width, and foot-base angle before visible gait abnormalities

    • Force plate measurements can identify changes in weight bearing and propulsion force

    • CatWalk or DigiGait systems provide quantitative parameters for early detection of subtle gait changes

  • Refined motor testing:

    • Rotarod testing with acceleration protocols can reveal endurance and coordination deficits

    • Grid walking tests to detect minor foot placement errors

    • Beam walking tests with varying beam widths to challenge motor control

    • Horizontal ladder tests with irregular rung patterns to assess skilled limb placement

  • Electrophysiological measurements:

    • Motor evoked potentials to assess corticospinal tract conduction

    • Sensory evoked potentials to detect sensory pathway involvement

    • Compound muscle action potentials to evaluate lower motor neuron function

    • Patch-clamp recordings of cortical motor neurons to detect alterations in intrinsic electrical properties

  • Molecular and cellular biomarkers:

    • Ultrastructural analysis of ER morphology in cortical motor neurons using electron microscopy

    • Immunohistochemical assessment of stress markers in potentially affected neurons

    • Analysis of axonal transport in primary neuronal cultures from REEP1 models

    • Proteomic analysis of cerebrospinal fluid for early disease markers

  • Functional imaging:

    • In vivo calcium imaging to assess neuronal activity patterns in motor cortex

    • Diffusion tensor imaging to detect early white matter tract changes

    • PET imaging with appropriate tracers to detect metabolic changes in motor pathways

By implementing these sensitive methodological approaches, researchers can identify phenotypic changes long before the onset of obvious motor symptoms, providing valuable windows for therapeutic intervention and deeper understanding of disease progression mechanisms in REEP1-related disorders.

What are promising approaches for developing REEP1-targeted therapeutics?

Several promising approaches are emerging for developing REEP1-targeted therapeutics:

  • Gene therapy strategies:

    • AAV-mediated delivery of functional REEP1 to cortical motor neurons

    • Development of mini-REEP1 constructs containing essential functional domains that can be packaged in AAV vectors

    • Use of neuron-specific promoters to achieve targeted expression in affected cells

  • Small molecule approaches:

    • High-throughput screening for compounds that:

      • Stabilize mutant REEP1 protein

      • Upregulate expression of remaining functional REEP1 allele in heterozygous patients

      • Enhance the function of other REEP family members to compensate for REEP1 deficiency

  • Alternative ER-shaping pathways:

    • Targeting other ER-shaping proteins (like reticulons or atlastins) to compensate for REEP1 deficiency

    • Modulating ER stress response pathways to enhance neuronal resilience

    • Developing compounds that promote ER tubule formation through REEP1-independent mechanisms

  • Axonal protection strategies:

    • Targeting mechanisms of axonal degeneration downstream of ER dysfunction

    • Enhancing mitochondrial function in affected neurons

    • Promoting axonal transport to maintain distal axon health

  • Precision medicine approaches:

    • Developing mutation-specific therapies for different REEP1 variants

    • Antisense oligonucleotides to address splicing mutations

    • RNA editing technologies to correct point mutations

The demonstrated dose-dependency of the phenotype in mouse models, where heterozygous mice show later onset and milder symptoms than homozygous knockouts , suggests that even partial restoration of REEP1 function could provide significant therapeutic benefit. This creates a favorable scenario for therapeutic development, as complete restoration of normal protein levels may not be necessary to achieve clinical improvement.

How might REEP1 research inform our understanding of other neurodegenerative diseases?

REEP1 research provides valuable insights that extend to broader neurodegenerative disease mechanisms:

  • ER morphology in neurodegeneration:

    • REEP1 studies establish a direct link between ER shaping and axonal survival , potentially informing research on other conditions where ER dysfunction is implicated, such as Alzheimer's disease, Parkinson's disease, and ALS

    • The connection between reduced peripheral ER complexity and axonal degeneration suggests a common vulnerability in neurons with extensive processes

  • Length-dependent axonopathies:

    • The selective vulnerability of long axons in REEP1-deficient mice provides a model for understanding why certain neurons are preferentially affected in various neurodegenerative conditions

    • This research supports the concept that maintaining cellular homeostasis becomes increasingly challenging with axonal length

  • Membrane protein trafficking:

    • REEP family proteins influence receptor trafficking and function , suggesting potential mechanisms by which membrane protein dysfunction could contribute to neurodegeneration

    • These insights may help explain the role of membrane protein mislocalization in diseases like Alzheimer's, where APP processing is altered

  • Dosage sensitivity:

    • The clear dosage effect observed in REEP1 models illuminates how partial loss of function can lead to late-onset, progressive neurodegeneration

    • This parallels other neurodegenerative conditions caused by haploinsufficiency of key proteins

  • Subcellular organelle interactions:

    • REEP1's role in ER shaping likely influences ER-mitochondria contact sites, which are increasingly recognized as critical in neurodegenerative diseases

    • This connection provides mechanistic insight into how defects in one organelle can cascade to dysfunction in others

By revealing fundamental cellular mechanisms linking ER architecture to axonal maintenance, REEP1 research contributes to our understanding of selective neuronal vulnerability, progressive degeneration, and potential therapeutic targets applicable across multiple neurodegenerative conditions.

What are the most significant gaps in our current understanding of REEP1 biology?

Despite significant advances, several important gaps remain in our understanding of REEP1 biology:

  • Molecular mechanisms of membrane shaping:

    • While REEP1 is known to be involved in ER shaping and membrane curvature induction , the precise molecular mechanisms and structural elements mediating these functions remain incompletely understood

    • How REEP1 coordinates with other ER-shaping proteins (reticulons, atlastins) to maintain the tubular ER network needs further elucidation

  • Axon-specific functions:

    • The selective vulnerability of long axons in REEP1 deficiency suggests axon-specific functions, but the nature of these functions and why they cannot be compensated by other REEP family members remains unclear

    • How REEP1 contributes to the distribution of ER throughout axons and whether it plays roles in axonal transport need further investigation

  • Developmental versus maintenance roles:

    • Whether REEP1 is primarily required during development for establishing proper neuronal architecture or continuously needed for maintaining axonal health remains to be determined

    • The temporal requirements for REEP1 function at different life stages are not well characterized

  • Interaction partners in neurons:

    • While some REEP proteins have been shown to interact with specific receptors like CXCR1 , the neuron-specific interaction partners of REEP1 are largely unknown

    • How these interactions might contribute to REEP1's function in neuronal ER maintenance needs investigation

  • Non-ER functions:

    • Potential roles of REEP1 beyond ER shaping, such as in other membrane compartments or in signaling pathways, remain unexplored

    • Whether REEP1 has functions independent of its membrane-shaping properties is uncertain

  • Compensatory mechanisms:

    • The cellular responses that attempt to compensate for REEP1 deficiency have not been systematically characterized

    • Identifying these compensatory pathways could reveal new therapeutic targets

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.