Recombinant Mouse Receptor expression-enhancing protein 3 (Reep3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Reep3; D10Ucla1; Receptor expression-enhancing protein 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-254
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Reep3
Target Protein Sequence
MVSWMISRAVVLVFGMLYPAYYSYKAVKTKNVKEYVRWMMYWIVFALYTVIETVADQTLA WFPLYYELKIAFVIWLLSPYTRGASLIYRKFLHPLLSSKEREIDDYIVQAKERGYETMVN FGRQGLNLAAAAAVTAAVKSQGAITERLRSFSMHDLTAIQGDEPVGHRPYQTLPEAKRKG KQATESPAYGIPLKDGSEQTDEEAEGPFSDDEMVTHKALRRSQSMKSVKTIKGRKEVRYG SLKYKVKKRPQVYF
Uniprot No.

Target Background

Function

Reep3 (Receptor expression-enhancing protein 3) is a microtubule-binding protein crucial for proper cell division and nuclear envelope reassembly. Its function involves sequestering the endoplasmic reticulum away from chromosomes during mitosis, likely by clearing the endoplasmic reticulum membrane from metaphase chromosomes.

Database Links
Protein Families
DP1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure and basic function of mouse REEP3?

Mouse REEP3 is a receptor expression-enhancing protein encoded by the REEP3 gene (Gene ID: 28193), with UniProt ID Q99KK1 . REEP3 belongs to the REEP family of proteins, which includes REEP1, REEP2, REEP4, REEP5, and REEP6. These proteins function primarily in enhancing the expression of cell surface receptors and are involved in membrane trafficking and shaping the endoplasmic reticulum.

REEP3 plays roles in cellular processes including protein trafficking, membrane organization, and potentially in neuronal function. Research indicates REEP3 participates in comprehensive gene interaction networks, sharing functional relationships with other REEP family members, particularly REEP1, REEP2, and REEP4, as evidenced by protein-protein interaction (PPI) network analysis .

How does REEP3 differ from other members of the REEP family?

While REEP family proteins share structural similarities, REEP3 has distinct tissue distribution patterns and functional properties. REEP3 forms part of an interaction network that encompasses REEP1, REEP2, REEP4, REEP5, REEP6, and ARL6IP5, as established through GeneMania database analysis .

STRING platform analysis reveals that REEP3's protein-protein interaction network contains 35 edges and 11 nodes, significantly encompassing REEP1, REEP2, and REEP4 . These interaction patterns suggest both overlapping and distinct functions among REEP family members, with REEP3 potentially having specialized roles in particular cellular contexts or tissues.

What are the primary biological pathways involving mouse REEP3?

REEP3 participates in several cellular pathways, including:

  • Membrane trafficking and organization

  • Endoplasmic reticulum shaping

  • Cell surface receptor expression enhancement

  • Potential involvement in neuronal development

Recent research has expanded our understanding of REEP3's role in biological networks through interaction studies with microRNAs (miRNAs) and RNA-binding proteins (RBPs), which were predicted using the StarBase database . These interactions suggest REEP3 may be subject to complex post-transcriptional regulation that influences its expression and function across different tissues and developmental stages.

What are the optimal methods for detecting and quantifying mouse REEP3 in biological samples?

For quantitative measurement of mouse REEP3 in biological samples, enzyme-linked immunosorbent assay (ELISA) is a highly effective method. ELISA kits designed specifically for mouse REEP3 can detect the protein in tissue homogenates, cell lysates, and other biological fluids with high sensitivity .

The standard detection range for commercial mouse REEP3 ELISA kits is typically 0.156 ng/ml to 10 ng/ml . For accurate results, sample concentrations should be adjusted to fall within the mid-range of the assay's detection limits. The colorimetric detection method provides quantitative data suitable for comparative analyses.

Methodological approach:

  • Sample preparation: Homogenize tissues or lyse cells according to standard protocols

  • Dilution optimization: Perform preliminary testing to determine optimal sample dilutions

  • Assay procedure: Follow the kit manufacturer's protocol precisely

  • Data analysis: Use standard curves to calculate REEP3 concentrations

  • Validation: Consider western blot or immunohistochemistry for confirmation

How should researchers design experiments to study REEP3 function in mouse models?

When designing experiments to investigate REEP3 function in mouse models, consider these methodological approaches:

  • Loss-of-function studies:

    • CRISPR/Cas9-mediated knockout of REEP3

    • siRNA-mediated knockdown in cell culture models

    • Conditional knockout systems for tissue-specific studies

  • Gain-of-function studies:

    • Overexpression of recombinant REEP3 using appropriate vectors

    • Inducible expression systems for temporal control

    • Tissue-specific expression using targeted promoters

  • Protein-protein interaction studies:

    • Co-immunoprecipitation to identify binding partners

    • Proximity ligation assays for in situ interaction detection

    • Yeast two-hybrid screening for novel interactions

  • Functional assays:

    • Membrane morphology analysis using fluorescence microscopy

    • Receptor trafficking assays with surface biotinylation

    • Subcellular localization studies using confocal microscopy

Each experimental approach should include appropriate controls and validation steps. For genetic manipulation studies, verify knockout/knockdown efficiency at both mRNA and protein levels before proceeding with functional analyses.

What purification strategies yield the highest quality recombinant mouse REEP3?

For generating high-quality recombinant mouse REEP3, the following purification strategy is recommended:

  • Expression system selection:

    • Mammalian expression systems (HEK293, CHO cells) maintain proper post-translational modifications

    • Baculovirus-insect cell systems offer good compromise between yield and proper folding

    • E. coli systems may be used with refolding protocols for higher yields

  • Affinity tag selection:

    • C-terminal 6-His tags facilitate purification while minimizing functional interference

    • Consider removable tags with protease cleavage sites if tag-free protein is needed

  • Purification protocol:

    • Initial capture using affinity chromatography (Ni-NTA for His-tagged proteins)

    • Intermediate purification using ion exchange chromatography

    • Polishing step with size exclusion chromatography

    • Buffer optimization to maintain protein stability

  • Quality control:

    • SDS-PAGE and western blot to verify purity and identity

    • Functional assays to confirm biological activity

    • Mass spectrometry for detailed characterization

For applications requiring carrier-free preparations, special consideration should be given to stability and storage conditions. Lyophilization from a 0.2 μm filtered solution in PBS is recommended, with reconstitution at appropriate concentrations in sterile PBS . Avoid repeated freeze-thaw cycles by storing aliquots at -20°C or -80°C.

How should researchers approach data table construction for REEP3 expression analysis?

When constructing data tables for REEP3 expression analysis, follow these principles for clear and accurate representation:

Example data table format:

Tissue TypeREEP3 Expression (ng/mg tissue)Mean ± SDFold Change vs. Control
Replicate 1Replicate 2Replicate 3
Brain0.8750.9230.9010.900 ± 0.0243.60
Liver0.2450.2560.2390.247 ± 0.0090.99
Kidney0.5130.4980.5220.511 ± 0.0122.04
Control0.2570.2420.2510.250 ± 0.0081.00

Ensure all data tables are self-contained with clear labeling, allowing readers to understand the data without referring to the main text .

What statistical methods are most appropriate for analyzing REEP3 expression differences between experimental groups?

For analyzing REEP3 expression differences between experimental groups, select statistical methods based on your experimental design and data characteristics:

  • For comparing two groups:

    • Student's t-test (parametric) for normally distributed data

    • Mann-Whitney U test (non-parametric) for non-normally distributed data

    • Paired t-test for matched samples (e.g., before/after treatment)

  • For comparing multiple groups:

    • One-way ANOVA with appropriate post-hoc tests (Tukey, Bonferroni) for normally distributed data

    • Kruskal-Wallis test with Dunn's post-hoc test for non-normally distributed data

    • Two-way ANOVA for experiments with two independent variables

  • For correlation analyses:

    • Pearson correlation for linear relationships between normally distributed variables

    • Spearman rank correlation for non-parametric relationships

  • For diagnostic value assessment:

    • ROC curve analysis with area under the curve (AUC) as evaluation criterion, where:

      • 0.50–0.60 = fail

      • 0.60–0.70 = poor

      • 0.70–0.80 = fair

      • 0.80–0.90 = good

      • 0.90–1 = excellent

  • For survival/prognostic analyses:

    • Kaplan-Meier curves for visualizing survival data

    • Cox regression models for assessing relationships between REEP3 expression and patient outcomes

Prior to analysis, ensure data meets test assumptions regarding normality, homogeneity of variance, and independence. Report statistical significance with appropriate p-values and confidence intervals, and consider multiple testing corrections for experiments involving numerous comparisons.

How can researchers effectively analyze REEP3 genetic correlations and potential causal relationships with disease states?

For analyzing genetic correlations and potential causal relationships between REEP3 and disease states, researchers should implement a comprehensive analytical approach:

This methodological framework allows researchers to systematically explore genetic links between REEP3 and disease phenotypes while accounting for potential confounding factors and establishing directionality in observed associations.

How can REEP3 function as a diagnostic or prognostic biomarker in disease models?

REEP3 shows promise as a diagnostic and prognostic biomarker in various disease models. To effectively investigate and validate its biomarker potential:

Research suggests that REEP3 expression patterns may correlate with specific disease processes, potentially providing valuable diagnostic and prognostic information. The development of robust ELISA methods for detecting mouse REEP3 facilitates these investigations in preclinical models , while translational studies can explore the relevance to human disease.

What approaches should be used to investigate REEP3 protein-protein interactions and their functional significance?

To comprehensively investigate REEP3 protein-protein interactions and their functional significance, implement a multi-faceted approach:

  • In silico prediction methods:

    • Leverage databases like GeneMania to establish comprehensive gene interaction networks involving REEP3 and related proteins (REEP1, REEP2, REEP4, REEP5, REEP6, ARL6IP5)

    • Utilize the STRING platform to explore protein-protein interaction (PPI) networks, which have revealed 35 edges and 11 nodes for REEP3

    • Predict interaction networks between REEP3's miRNAs and RNA-binding proteins (RBPs) using databases like StarBase

  • Experimental verification methods:

    • Co-immunoprecipitation (Co-IP) followed by mass spectrometry for unbiased identification of interaction partners

    • Proximity ligation assay (PLA) for detecting protein interactions in situ with subcellular resolution

    • Bimolecular fluorescence complementation (BiFC) for visualizing protein interactions in living cells

    • Förster resonance energy transfer (FRET) for quantifying protein proximity and interaction dynamics

  • Functional validation strategies:

    • Mutagenesis studies targeting predicted interaction domains

    • Competition assays with peptide inhibitors of specific interactions

    • Domain mapping to identify critical regions for protein-protein binding

    • Phenotypic rescue experiments in knockout/knockdown models

  • Systems biology integration:

    • Network analysis to identify interaction hubs and central nodes

    • Pathway enrichment analysis to understand biological context of interactions

    • Dynamic modeling of interaction networks under different cellular conditions

These approaches allow researchers to move beyond identification of binding partners to understand the functional consequences of REEP3 interactions in both physiological and pathological contexts, potentially revealing therapeutic targets for intervention.

What genetic analysis methods reveal the relationship between REEP3 variants and disease susceptibility?

To elucidate relationships between REEP3 genetic variants and disease susceptibility, researchers should employ a comprehensive genetic analysis framework:

This comprehensive approach enables researchers to move beyond association to understand the potential causal relationships between REEP3 variants and disease phenotypes, providing insights into disease mechanisms and potential therapeutic targets.

What are common challenges in REEP3 detection assays and how can they be addressed?

Researchers frequently encounter several challenges when detecting REEP3 in experimental systems. Here are common issues and methodological solutions:

  • Low signal-to-noise ratio:

    • Solution: Optimize antibody concentrations and blocking conditions; increase sample concentration within the linear range of the assay (0.156 ng/ml - 10 ng/ml for typical ELISA kits) ; extend substrate incubation time while monitoring background.

    • Validation: Run parallel assays with positive controls of known concentration to establish sensitivity thresholds.

  • Cross-reactivity with other REEP family proteins:

    • Solution: Select antibodies validated for specificity against REEP3; perform preliminary testing with recombinant REEP family proteins to assess cross-reactivity.

    • Validation: Confirm specificity using samples from REEP3 knockout models or cells with REEP3 knockdown.

  • Sample matrix interference:

    • Solution: Dilute samples appropriately to minimize matrix effects; use carrier-free preparations when necessary; implement additional purification steps before analysis.

    • Validation: Perform spike-and-recovery experiments with known amounts of recombinant REEP3 added to sample matrix.

  • Protein degradation during sample processing:

    • Solution: Incorporate protease inhibitors in all buffers; maintain cold chain throughout processing; minimize freeze-thaw cycles.

    • Validation: Compare fresh samples with those subjected to various storage conditions by western blot to assess integrity.

  • Inconsistent results between detection methods:

    • Solution: Standardize sample preparation protocols; validate each method independently before comparison; consider the differential sensitivity of various techniques.

    • Validation: Analyze a standard reference set of samples using multiple detection methods to establish correlation factors.

For ELISA-based detection specifically, ensure optimal dilutions are determined empirically for each sample type, as recommended by commercial kit providers .

How can researchers address data inconsistencies when comparing REEP3 expression across different experimental platforms?

When confronting data inconsistencies in REEP3 expression analyses across different experimental platforms, implement these methodological strategies:

  • Standardization of reference materials:

    • Establish common calibration standards usable across platforms

    • Create shared reference samples to be analyzed on all platforms

    • Develop normalization factors based on these common references

  • Technical validation procedures:

    • Perform parallel analyses of the same samples across platforms

    • Calculate conversion factors to harmonize data between methods

    • Identify platform-specific biases through Bland-Altman analysis

  • Statistical approaches to data integration:

    • Apply batch correction algorithms (ComBat, RUV, etc.) to remove systematic biases

    • Implement meta-analysis techniques to combine results from different platforms

    • Use latent variable models to identify shared patterns across datasets

  • Experimental design considerations:

    • Include technical and biological replicates across all platforms

    • Randomize sample processing order to minimize batch effects

    • Include platform-specific positive and negative controls

  • Documentation and reporting standards:

    • Document detailed methodological protocols for each platform

    • Report raw data alongside normalized results

    • Clearly state normalization methods and their underlying assumptions

When analyzing data tables, maintain consistent precision with the same number of decimal places (significant digits) throughout to ensure proper comparison . For meaningful integration, consider the detection ranges of different platforms (e.g., ELISA kits with ranges of 0.156 ng/ml - 10 ng/ml) and adjust analyses accordingly.

What methodological refinements improve the reproducibility of REEP3 functional studies?

To enhance reproducibility in REEP3 functional studies, implement these methodological refinements:

  • Standardized protein preparations:

    • Use consistent expression systems for recombinant protein production

    • Implement rigorous quality control measures (SDS-PAGE, mass spectrometry)

    • Characterize each batch for purity, activity, and stability

    • Consider using carrier-free preparations for applications where BSA might interfere

  • Validated genetic tools:

    • Sequence-verify all constructs used for REEP3 expression or knockdown

    • Quantify knockdown/overexpression efficiency at both mRNA and protein levels

    • Use multiple independent siRNAs or shRNAs to control for off-target effects

    • Implement rescue experiments with siRNA-resistant constructs

  • Comprehensive controls:

    • Include positive and negative controls in all functional assays

    • Use related REEP family proteins as specificity controls

    • Implement biological replicates across independent experiments

    • Include technical replicates to assess methodological variance

  • Detailed protocol documentation:

    • Record all experimental parameters, including buffer compositions, incubation times, and temperatures

    • Standardize protocols across laboratory members

    • Create detailed standard operating procedures (SOPs) for core techniques

  • Advanced analytical approaches:

    • Implement blinded analysis to minimize experimenter bias

    • Preregister experimental designs and analysis plans when feasible

    • Use appropriate statistical methods with consideration of multiple testing

    • Report effect sizes along with statistical significance

For stability and storage, recombinant REEP3 should be handled according to manufacturer recommendations, typically stored at -20°C or -80°C after reconstitution from lyophilized form to avoid repeated freeze-thaw cycles which can compromise protein integrity .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.