Recombinant Mouse Receptor expression-enhancing protein 5 (Reep5)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Reep5; Dp1; Receptor expression-enhancing protein 5; GP106; Polyposis locus protein 1 homolog; Protein TB2 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-185
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MRERFDRFLHEKNCMTDLLAKLEAKTGVNRSFIALGVIGLVALYLVFGYGASLLCNLIGF GYPAYISMKAIESPNKDDDTQWLTYWVVYGVFSIAEFFSDLFLSWLPFYYMLKCGFLLWC MAPSPANGAEMLYRRIIRPIFLRHESQVDSVVKDVKDKAKETADAISKEVKKATVNLLGD VKKST
Uniprot No.

Target Background

Function
May promote functional cell surface expression of olfactory receptors.
Database Links
Protein Families
DP1 family
Subcellular Location
Membrane; Multi-pass membrane protein. Endoplasmic reticulum.

Q&A

What is REEP5 and what are its primary functions in cardiac tissue?

REEP5 (Receptor Expression-Enhancing Protein 5) is a 189 amino acid multi-pass membrane protein that is highly expressed in cardiac tissue . It belongs to the DP1 family and is also known by several aliases including C5orf18, DP1, TB2, and D5S346 . REEP5 plays a critical role in regulating the organization of the highly differentiated sarco(endo)plasmic reticulum (SR/ER) network, which is essential for numerous cellular processes including calcium handling and protein synthesis .

In cardiac myocytes, REEP5 maintains SR/ER membrane stability and is essential for proper cardiac function . It helps form high curvature SR/ER tubules that are required for proper association with t-tubules and propagation of cardiac excitation-contraction coupling signals . REEP5 is also thought to promote the functional cell surface expression of olfactory receptors, suggesting diverse roles across different tissues .

How is REEP5 structurally characterized and what conservation exists across species?

REEP5 is a member of the DP1/REEP/Yop1 family of proteins characterized by their ability to shape ER tubules through membrane curvature stabilization. The human REEP5 protein shares high sequence homology with mouse and rat orthologs, with approximately 93% sequence identity in both cases . This high conservation suggests critical functional importance across mammalian species.

The recombinant protein fragment used for research purposes typically contains amino acids 59-85 of the human REEP5 sequence, which represents a highly conserved region . The protein contains multiple transmembrane domains that anchor it within the SR/ER membrane, allowing it to influence membrane curvature and organization.

What experimental models are available for studying REEP5 function?

Several experimental models have been developed to study REEP5 function:

  • In vitro cell culture models: Cardiac myocytes with REEP5 depletion show SR/ER membrane destabilization, decreased contractility, and disrupted calcium handling .

  • Zebrafish models: CRISPR/Cas9-mediated REEP5 loss-of-function zebrafish mutants demonstrate sensitized cardiac dysfunction when challenged with heart failure induction via verapamil treatment .

  • Mouse models: In vivo adeno-associated virus serotype 9 (rAAV9)-mediated gene delivery has been used to knock down REEP5 in mouse hearts, resulting in cardiac dysfunction, dilated cardiac chambers, increased fibrosis, and reduced ejection fraction .

  • Recombinant protein studies: Purified recombinant REEP5 protein fragments can be used for blocking experiments, protein interaction studies, and as controls in antibody validation .

What methodologies are optimal for REEP5 knockdown in cardiac models?

For researchers investigating REEP5 function through loss-of-function approaches, multiple validated methodologies have been established:

  • rAAV9-mediated knockdown: Recombinant adeno-associated virus serotype 9 (rAAV9) has proven effective for cardiac-specific REEP5 knockdown in mice. The most significant reduction in REEP5 expression (approximately 78%) was observed 4 weeks post-rAAV9 injection as confirmed by immunoblotting analysis (p<0.0001, n=6-8) . This approach leads to lethal cardiac dysfunction at 5 weeks post-knockdown, providing a valuable model for studying severe cardiac phenotypes .

  • CRISPR/Cas9 genome editing: CRISPR/Cas9-mediated REEP5 loss-of-function has been successfully implemented in zebrafish models. This approach allowed researchers to study developmental cardiac phenotypes and sensitized responses to heart failure induction with verapamil treatment .

  • siRNA/shRNA approaches: In vitro knockdown in isolated cardiac myocytes can be achieved using standard RNA interference techniques. This approach is particularly useful for examining immediate cellular effects of REEP5 depletion, including SR/ER structural changes and calcium handling defects .

When selecting a knockdown methodology, researchers should consider the required knockdown efficiency, temporal aspects of the experiment, and specific cardiac parameters being investigated.

How can researchers effectively assess SR/ER structural changes following REEP5 manipulation?

Assessment of SR/ER structural changes following REEP5 manipulation requires specialized imaging and biochemical techniques:

  • High-resolution confocal microscopy and 3D mapping: These approaches have been successfully employed to examine localization and expression patterns of key SR/ER proteins following REEP5 knockdown . Three-dimensional co-immunofluorescence imaging allows visualization of REEP5 localization to different functional domains of the SR/ER network in cardiac myocytes, including the tubular/longitudinal network and junctional SR .

  • Electron microscopy: This method provides ultrastructural details revealing SR/ER membrane destabilization and luminal vacuolization following REEP5 depletion . Electron microscopy is particularly valuable for documenting the failure to form high curvature SR/ER tubules in the absence of REEP5.

  • Organelle-specific proteomic profiling: Subcellular fractionation combined with mass spectrometry (nLC-ESI-MS-HCD-MS) has been used to establish organelle-specific cardiac proteomic profiles of microsomes, mitochondria, and cytosol following REEP5 knockdown . This approach identifies proteins with altered expression, providing insights into the molecular consequences of REEP5 depletion.

The combination of these complementary approaches provides a comprehensive assessment of SR/ER structural and functional changes associated with REEP5 manipulation.

What functional assays are recommended for evaluating REEP5's impact on cardiac contractility?

To evaluate the functional impact of REEP5 on cardiac contractility, researchers should consider the following methodologies:

  • Isolated cardiomyocyte contractility measurements: Direct measurement of cardiomyocyte contractility following REEP5 depletion has demonstrated decreased muscle cell contraction . This approach allows for the precise quantification of contraction parameters at the cellular level.

  • Calcium signaling analysis: REEP5 depletion results in disrupted Ca2+ signaling in cardiomyocytes . Calcium imaging using fluorescent indicators can quantify alterations in calcium handling, providing insights into the mechanisms underlying contractility defects.

  • Echocardiography: In vivo assessment of cardiac function following AAV9-mediated REEP5 knockdown in mice has revealed cardiac dysfunction with dilated cardiac chambers and reduced ejection fraction . Echocardiography provides valuable data on whole-heart function that complements cellular studies.

  • Analysis of cardiac fibrosis: Histological examination of cardiac tissue following REEP5 knockdown has shown increased cardiac fibrosis , which can contribute to contractile dysfunction. Quantification of fibrosis through histological staining provides an additional parameter for assessing cardiac remodeling.

These complementary approaches enable a comprehensive assessment of REEP5's impact on cardiac contractility at both cellular and organ levels.

How can researchers characterize the REEP5 interactome to understand its molecular partnerships?

Understanding REEP5's molecular interactions is crucial for elucidating its functional roles. The following methodologies have proven effective:

  • Mass spectrometry-based interactome analysis: This approach has successfully identified several REEP5 protein interactions . The technique typically involves immunoprecipitation of REEP5 followed by mass spectrometric identification of co-precipitated proteins.

  • Co-immunoprecipitation studies: This method has validated specific protein-protein interactions involving REEP5 . It provides a targeted approach for confirming interactions identified through mass spectrometry or testing hypothesized interactions.

  • Proximity labeling techniques: Although not explicitly mentioned in the search results, techniques such as BioID or APEX2 proximity labeling could provide valuable information about proteins in close proximity to REEP5 within the SR/ER membrane.

  • Yeast two-hybrid screening: This method could be employed to identify direct protein-protein interactions involving REEP5, complementing the other approaches that may detect both direct and indirect interactions.

By combining these techniques, researchers can build a comprehensive map of the REEP5 interactome, revealing functional networks and potential regulatory mechanisms.

What molecular mechanisms mediate REEP5's role in SR/ER organization?

REEP5 contributes to SR/ER organization through several molecular mechanisms:

  • Membrane curvature stabilization: As a member of the DP1/REEP/Yop1 family, REEP5 stabilizes high-curvature ER tubules. Without REEP5, the SR membrane network fails to form high curvature SR/ER tubules required for proper association with t-tubules .

  • Protein trafficking regulation: REEP5 is thought to promote the functional cell surface expression of certain receptors , suggesting a role in protein trafficking within the SR/ER network.

  • SR/ER stress response modulation: REEP5 is involved in regulating cellular stress responses, particularly those related to SR/ER stress . This function may involve interactions with stress response proteins and signaling pathways.

  • Interaction with calcium handling machinery: REEP5 localization to the junctional SR suggests functional interactions with the calcium handling machinery responsible for excitation-contraction coupling .

Understanding these molecular mechanisms provides insights into how REEP5 maintains SR/ER integrity and function in cardiac myocytes.

What are the optimal procedures for using recombinant mouse REEP5 in experimental protocols?

When working with recombinant mouse REEP5 protein:

  • Storage and handling: Recombinant REEP5 should be stored according to manufacturer recommendations, typically at -80°C for long-term storage with minimal freeze-thaw cycles to preserve activity.

  • Blocking experiments: Recombinant REEP5 protein fragments can be used for blocking experiments with corresponding antibodies. For optimal results, use a 100x molar excess of the protein fragment control based on antibody concentration and molecular weight . Pre-incubate the antibody-protein control fragment mixture for 30 minutes at room temperature before use in IHC/ICC or Western blot experiments .

  • Quality control: Verify protein integrity by SDS-PAGE and functional activity through appropriate binding or functional assays before experimental use.

  • Cross-species considerations: When using mouse REEP5 in cross-species experiments, consider the high sequence homology between mouse and human (93%) , which suggests potential cross-reactivity but may still introduce variables in certain experimental contexts.

How can gene therapy approaches targeting REEP5 be optimized for cardiovascular applications?

Based on successful REEP5 gene manipulation studies, researchers interested in gene therapy approaches should consider:

  • Viral vector selection: rAAV9 has demonstrated effective cardiac-specific delivery for REEP5 knockdown in mice . This serotype shows strong tropism for cardiac tissue, making it suitable for cardiovascular applications.

  • Dosage and timing considerations: Significant REEP5 knockdown (78%) was observed 4 weeks post-rAAV9 injection, with lethal cardiac dysfunction developing at 5 weeks . This temporal progression should inform experimental design and therapeutic strategies.

  • Alternative gene transfer methods: For in vitro studies, nucleofection has been successfully used to transfer DNA into intervertebral disc cells and could potentially be adapted for cardiac cells . This approach provides an alternative to viral vectors for certain applications.

  • Therapeutic potential: Studies suggest that GDF-5 can increase the expression of genes for extracellular matrix proteins . While not directly related to REEP5, this illustrates how gene therapy approaches targeting SR/ER proteins might influence extracellular matrix remodeling in cardiac disease contexts.

  • Ex vivo approaches: Novel ex vivo gene transfer techniques might provide advantages for therapeutic applications by allowing manipulation of cells outside the body before reimplantation .

What analytical techniques are recommended for quantifying REEP5 expression changes?

For precise quantification of REEP5 expression:

  • Western blotting: Immunoblotting has been successfully used to quantify REEP5 knockdown efficiency (78% reduction following rAAV9-mediated knockdown) . This technique provides reliable protein-level quantification when performed with appropriate loading controls and replicate samples (n=6-8 used in published studies) .

  • Real-time RT-PCR: While not specifically mentioned for REEP5 in the search results, quantitative PCR is a standard approach for measuring changes in gene expression at the mRNA level. This technique has been used to assess expression changes in extracellular matrix genes following GDF-5 treatment .

  • Immunohistochemistry and immunofluorescence: These techniques provide spatial information about REEP5 expression changes in tissue sections or cultured cells. High-resolution confocal microscopy and 3D mapping techniques have been employed to examine localization and expression patterns of SR/ER proteins following REEP5 knockdown .

  • Proteomics approaches: Mass spectrometry (nLC-ESI-MS-HCD-MS) coupled with subcellular fractionation provides comprehensive analysis of protein expression changes across different cellular compartments following REEP5 manipulation .

Each technique offers distinct advantages, and combining multiple approaches provides the most robust assessment of REEP5 expression changes.

What are the current limitations in REEP5 research models and how might they be addressed?

Current REEP5 research faces several limitations:

  • Temporal control of knockdown: The rAAV9-mediated knockdown system achieves maximal effect at 4 weeks post-injection , which may not allow for studying acute effects. Inducible knockdown or knockout systems could provide better temporal control.

  • Cell-type specificity: While cardiac enrichment of REEP5 has been established , expression is detected across multiple tissues . Developing cell-type specific manipulation models would help dissect REEP5 functions in different contexts.

  • Compensatory mechanisms: Long-term REEP5 depletion may trigger compensatory upregulation of related proteins. Studies examining temporal changes in the expression of other REEP family members following REEP5 knockdown would address this limitation.

  • Mechanistic depth: While REEP5's role in SR/ER organization has been established , the precise molecular mechanisms remain incompletely defined. Structural studies and more detailed interactome analysis would enhance mechanistic understanding.

  • Translation to human disease: Most REEP5 studies utilize animal models . Validating findings in human tissues and exploring REEP5 variations in human cardiac disease would improve translational relevance.

Addressing these limitations through novel experimental approaches and model systems will advance REEP5 research toward potential therapeutic applications.

How might REEP5 function interface with other cardiac stress response pathways?

REEP5's role in stress response suggests potential interfaces with established cardiac stress pathways:

  • Unfolded protein response (UPR): REEP5's localization to the SR/ER and role in membrane organization suggest potential involvement in the UPR, which is activated by ER stress and plays a critical role in cardiac pathophysiology.

  • Calcium handling pathways: REEP5 depletion disrupts calcium signaling , suggesting interfaces with calcium-dependent stress response pathways including calcineurin-NFAT signaling.

  • Mitochondrial function: The established organelle-specific cardiac proteomic profile following REEP5 knockdown included analysis of mitochondrial fractions , suggesting potential cross-talk between SR/ER and mitochondrial function.

  • Extracellular matrix remodeling: Cardiac fibrosis was observed following REEP5 knockdown in vivo , suggesting interfaces with pathways regulating extracellular matrix production and remodeling.

Future research exploring these interfaces would provide a more comprehensive understanding of REEP5's role in cardiac stress responses and potential therapeutic targeting strategies.

What are the implications of REEP5 research for human cardiac disease?

REEP5 research has several important implications for human cardiac disease:

  • Heart failure mechanisms: REEP5 knockdown leads to cardiac dysfunction with dilated cardiac chambers and reduced ejection fraction , resembling dilated cardiomyopathy and heart failure. Understanding REEP5's role may reveal novel mechanistic insights into these conditions.

  • SR/ER stress in cardiac pathophysiology: REEP5's function in SR/ER organization and stress responses connects to a growing body of evidence implicating SR/ER stress in various cardiac diseases, including heart failure, ischemia/reperfusion injury, and diabetic cardiomyopathy.

  • Potential biomarker: While not explicitly explored in the search results, REEP5 expression or modification patterns could potentially serve as biomarkers for specific cardiac stress states or disease progression.

  • Therapeutic target: REEP5's critical role in cardiac function suggests it could represent a novel therapeutic target. Strategies aimed at preserving or enhancing REEP5 function might protect against SR/ER stress-induced cardiac dysfunction.

Further research exploring REEP5 expression and function in human cardiac disease samples would strengthen these translational implications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.