Recombinant Mouse Relaxin receptor 1 (Rxfp1)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Characteristics

Mouse RXFP1 is encoded by the Rxfp1 gene located on chromosome 3 (Table 1) . The receptor shares 89% amino acid identity with human RXFP1 but exhibits key structural divergences affecting ligand interactions .

Reproductive and Cardiovascular Functions

Mouse RXFP1 is indispensable for:

  • Cervical softening and mammary gland development during pregnancy .

  • Cardiovascular regulation, including increased cardiac output and glomerular filtration rate .

  • Anti-fibrotic effects, with RXFP1 deficiency leading to age-related fibrosis in multiple organs .

Species-Specific Signaling

  • Ligand specificity: Mouse relaxin-1 (M1) binds RXFP1 with lower affinity than human relaxin-2 (H2), partly due to Tyr184 in the A-chain .

  • Small-molecule activation: ML290, a biased agonist for human RXFP1, fails to activate mouse RXFP1 due to divergent residues in the third extracellular loop (ECL3) .

Signaling Mechanisms

Mouse RXFP1 activates multiple pathways (Figure 1):

  1. Primary cAMP pathway: Couples to Gαs, increasing cyclic adenosine monophosphate (cAMP) .

  2. Secondary pathways:

    • Delayed cAMP surge via Gαi3-PI3K-PKCζ .

    • ERK1/2 and p38 MAPK activation in vascular cells .

Key divergence: Unlike human RXFP1, mouse RXFP1 does not recruit ERK1/2 signaling in response to ML290 .

Recombinant Expression Systems

  • HEK293 cells: Widely used for transient or stable expression of mouse RXFP1 to study cAMP dynamics .

  • BacMam luciferase assays: Enable high-throughput screening of receptor activity .

Humanized Mouse Models

  • RXFP1 knock-in mice: Replace mouse Rxfp1 with human RXFP1 to enable ML290 testing .

    • Demonstrated target engagement via heart rate modulation and osmolality changes .

Table 2: Key Findings from Recombinant Mouse RXFP1 Studies

Study FocusKey InsightSource
Ligand specificityTyr184 reduces M1 relaxin affinity
ML290 insensitivityECL3 residues block small-molecule binding
Fibrosis phenotypesRXFP1 deficiency causes organ fibrosis
Chimeric receptor analysisEctodomain dictates relaxin response

Challenges and Therapeutic Implications

  • Species limitations: Mouse RXFP1’s poor response to ML290 necessitates humanized models for preclinical drug testing .

  • Fibrosis therapy: Reduced RXFP1 expression in fibrotic tissues may compromise relaxin’s efficacy, highlighting the need for receptor upregulation strategies .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have specific requirements regarding the format, please indicate your preference in the order notes, and we will prepare the product accordingly.
Lead Time
Delivery times may vary depending on the purchase method and location. For specific delivery estimates, please consult your local distributors.
Note: Our proteins are standardly shipped with regular blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. The shelf life of lyophilized forms is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during the production process. If you have a preferred tag type, please specify it, and we will prioritize developing the product with the designated tag.
Synonyms
Rxfp1; Gm1018; Lgr7; Relaxin receptor 1; Leucine-rich repeat-containing G-protein coupled receptor 7; Relaxin family peptide receptor 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-758
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MTSGPFFFCIFIIGKYFTLGSAQDVSCPLGSFPCGNMSRCLPQLLHCNGVDDCGNRADED HCGDNNGWSLQLDKYFANYYKLASTNSFEAETSECLVGSVPMHCLCRDLELDCDEANLRA VPSVSSNVTVMSLQRNFIRTLPPNGFRKYHELQKLCLQNNRIHSVSVSAFRGLRSLTKLY LSHNRITFLKPGVFEDLHRLEWLIIEDNHLSRISPLTFYGLNSLILLVLMNNALTRLPDK PLCQHMPRLHWLDFEGNRIHNLRNLTFISCNNLTVLVMRKNKINYLNEHAFTHLQKLDEL DLGSNKIENLPPNIFKDLKELSQLNISYNPIQKIEVNQFDCLAKLKSLSLEGIEISNIQQ RMFRPLINLSHIYFKKFQYCGYAPHVRSCKPNTDGISSLENLLASIIQRVFVWVVSAITC FGNIFVICMRPYIRSENKLHAMSIISLCCADCLMGVYLFVIGAFDLKFRGEYNKHAQPWM ESVHCQFMGSLAILSTEVSVLLLTFLTLEKYICIVYPFRCLRPRKCRTITVLIFIWIIGF IVAFAPLGNKEFFKNYYGTNGVCFPLHSEDTGSTGAQIYSVVIFLGINLVAFIIIVFSYG SMFYSVHQSSVTVTEIQKQVKKEVVLAKRFFFIVFTDALCWIPIFILKFLSLLQVEIPDS ITSWVVIFILPINSALNPIIYTLTTRPFKEMIHQLWHNYRQRRSVDRKETQKAYAPSFIW VEMWPLQEMSSGFMKPGAFTDPCDLSLVSQSSRLNSYS
Uniprot No.

Target Background

Function
Relaxin receptor 1 (RXFP1) is a G protein-coupled receptor responsible for mediating the actions of relaxin peptides. Activation of RXFP1 stimulates adenylate cyclase, leading to an increase in cyclic adenosine monophosphate (cAMP) levels. Binding of relaxin to RXFP1 may also activate a tyrosine kinase pathway that inhibits the activity of a phosphodiesterase that degrades cAMP.
Gene References Into Functions
  1. No significant differences were observed in RXFP1 expression associated with aging. PMID: 26109313
  2. RXFP1 is expressed in smooth muscle cells of the muscular wall and in neurons of the myenteric plexus within colonic tissue. PMID: 26360621
  3. Relaxin/RXFP1 signaling in smooth muscle cells plays a crucial role in normal collagen turnover and relaxation of the pubic symphysis during pregnancy. PMID: 25715795
  4. Maternal exposure to simazine has been linked to disruptions in relaxin signaling pathways and testicular dysfunction. PMID: 22984576
  5. H3 relaxin exhibits antifibrotic effects through the RXFP1 receptor. PMID: 21229994
  6. Downregulation of RXFP1 resulted in a significant reduction in metastasis rate in PC3 tumors. PMID: 20861284
  7. RXFP1 functions in an autocrine and/or paracrine manner upstream of PCDHY in regulating increased canonical Wnt signaling in prostate cancer. PMID: 20503398
  8. LGR7, a related receptor, has been identified as the relaxin receptor in mouse and rat species. PMID: 15566402
  9. Mouse and rat LGR7 have been shown to bind and be activated by relaxin ligands. PMID: 15956680
  10. LGR7-Truncate is a potential endogenous regulator of LGR7 signaling. PMID: 15956683
  11. Gene expression profiling of Lgr7 in the adult mouse brain has been investigated. PMID: 15956708
  12. Expression of lgr7 in mouse brain membranes and neurons has been documented. PMID: 15956710
  13. Inhibition of androgen-independent growth has been achieved by blocking expression of LGR7, the cognate receptor of H2 relaxin. PMID: 16434975
  14. LGR7-expressing cells in the stroma are both essential and sufficient for relaxin to stimulate proliferation and inhibit apoptosis in both stromal and epithelial cells of the cervix and vagina. PMID: 18218691
  15. RXFP1 is involved in mediating relaxin's effects on airway fibrosis during homeostasis, but not during inflammation-induced fibrosis associated with chronic allergic airways disease. PMID: 18974264
  16. Research indicates that cardiac RXFP1 expression is increased in hearts of transgenic mice with cardiomyocyte-restricted overexpression of alpha1A-AR, alpha1B-AR, or beta2-AR, demonstrating distinct regulation by adrenergic signaling of cardiac RXFP1 expression. PMID: 19416204

Show More

Hide All

Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is mouse Rxfp1 and how does it differ from human RXFP1?

These differences are functionally significant as they result in species-specific activation patterns. For example, the small molecule agonist ML290 activates human, macaque, and pig RXFP1, but does not activate mouse Rxfp1 . This species-specific activation is important to consider when designing experiments and selecting appropriate animal models for testing relaxin receptor modulators.

How is Rxfp1 activation measured in experimental settings?

Rxfp1 activation is primarily measured through cAMP production assays since RXFP1 signaling leads to increased intracellular cAMP. Two common methodologies are:

  • CRE-Luc BacMam luciferase assay: This technique measures increased luciferase activity resulting from cAMP production following receptor stimulation. Cells expressing the receptor of interest are stimulated for a defined period (typically 2 hours), and then luciferase activity is measured . This method is sensitive enough to detect differences in EC50 values between species variants of the receptor.

  • Direct cAMP HTRF assay: This is another technique used to measure cAMP levels directly rather than through a reporter system .

Additional downstream effects that can be measured include increased phosphorylation of extracellular signal-regulated kinase 1/2 (ERK1/2), MAPK, tyrosine kinase activation, and nitric oxide (NO) signaling . When designing experiments, researchers should choose an appropriate assay based on the specific aspect of RXFP1 signaling they wish to investigate.

What are the primary ligands used to study Rxfp1 function?

The primary ligands used to study Rxfp1 function include:

  • Relaxin peptides: The natural ligand for RXFP1 is relaxin peptide (RLN). Researchers often use species-specific RLN including human, mouse, and porcine relaxin, which can have different activation potencies across receptor variants . Typically, recombinant relaxin peptides are used at concentrations around 10 nM for receptor activation studies .

  • Small molecule agonists: ML290 is the lead compound of this class. It activates human, macaque, and pig RXFP1 but not mouse or rat Rxfp1 . It is typically used at concentrations of 5 μM in in vitro studies and 1 mg/25 g body weight for in vivo experiments .

When selecting ligands for Rxfp1 research, it's crucial to consider species compatibility. For example, rabbit RXFP1 variants have been found to be unresponsive to human, pig, and mouse relaxin peptides, but responsive to ML290, indicating complex species-specific receptor-ligand interactions .

What structural elements of Rxfp1 are critical for relaxin binding versus small molecule activation?

The interaction between Rxfp1 and its ligands involves distinct structural elements for peptide binding versus small molecule activation:

  • Relaxin binding mechanism: Relaxin binding to RXFP1 involves a two-step process. Primary high-affinity binding occurs within the leucine-rich repeats (LRRs) in the extracellular domain, while secondary low-affinity interaction occurs via the second extracellular loop (ECL) of the seven-transmembrane (7TM) region . The LDLa domain is not necessary for binding but is essential for activation of receptor signaling .

  • Small molecule activation: Small molecules like ML290 interact differently with the receptor. Studies with chimeric human-mouse and guinea pig-human RXFP1 constructs have established that amino acid differences in the third extracellular loop (ECL) of the 7TM domain are responsible for the species specificity of ML290 activation . This explains why ML290 activates human RXFP1 but not mouse Rxfp1.

The allosteric mode of action is confirmed by experiments with chimeric receptors. Chimeras with human ectodomain and rabbit 7TM domain were activated by relaxin, whereas substitution of part of the guinea pig 7TM domain with human sequence only partially restored ML290 activation . This underscores the distinct binding and activation mechanisms for peptide versus small molecule ligands.

How does the creation of humanized Rxfp1 mice advance preclinical testing of RXFP1 modulators?

The creation of humanized Rxfp1 mice represents a significant advancement for preclinical testing of RXFP1 modulators for several reasons:

  • Overcoming species-specific activation barriers: Since small molecule agonists like ML290 don't activate rodent Rxfp1, traditional mouse models have limited utility for testing these compounds. Humanized Rxfp1 mice with human RXFP1 knock-in provide a solution to this problem .

  • Preservation of physiological expression patterns: In the humanized model, the human RXFP1 cDNA is inserted into the mouse Rxfp1 gene locus, ensuring that the transcriptional expression pattern of the human RXFP1 allele remains similar to the native mouse Rxfp1 . This preserves physiological relevance.

  • Functional complementation: Female mice homozygous for human RXFP1 show normal relaxation of the pubic symphysis at parturition and normal development of mammary nipples and vaginal epithelium, indicating that the human receptor fully complements the functions of mouse Rxfp1 .

  • Validated target engagement: Intravenous injection of relaxin leads to increased heart rate in both humanized and wild-type females, whereas ML290 increases heart rate only in humanized mice . This differential response confirms target engagement by ML290 specifically through the human RXFP1.

The humanized Rxfp1 mouse model therefore provides a valuable platform for testing human RXFP1 modulators in various genetic and experimentally induced mouse models of human diseases, bridging the gap between in vitro studies and clinical trials.

What are the challenges in interpreting cross-species relaxin receptor activation data?

Interpreting cross-species relaxin receptor activation data presents several challenges:

  • Structural variations: Multiple sequence analysis shows significant diversity among RXFP1 receptors from different species. Rabbit RXFP1, for example, is the most divergent with multiple substitutions in amino acid positions that are conserved among other species . These variations can affect ligand binding and activation.

  • Differential ligand responses: The same ligand can evoke different responses across species. For instance, while ML290 strongly activates human, macaque, and pig RXFP1, it shows limited activation of guinea pig RXFP1 and no activation of mouse Rxfp1 . Similarly, rabbit RXFP1 variants respond to ML290 but not to human, pig, or mouse relaxin peptides .

  • Alternative splicing complexities: Some species exhibit alternative splicing of RXFP1, creating multiple receptor variants. In rabbit, two splice variants of RXFP1 were identified through alternative splicing of the fourth exon . These variants may have different functional properties and ligand responses.

  • Assay-dependent variations: Different assay systems may yield varying results. The mouse Rxfp1 response to ML290 has shown some discrepancies between direct cAMP HTRF assay and CRE-Luc BacMam luciferase assay .

To address these challenges, researchers should employ multiple complementary approaches, including chimeric receptor studies, comparative sequence analyses, and functional assays with receptors from multiple species. When interpreting data, the specific receptor variant, assay system, and ligand used should be carefully considered.

What expression systems are most appropriate for studying recombinant Rxfp1?

When selecting expression systems for studying recombinant Rxfp1, researchers should consider several factors:

  • HEK293T cells: These cells are commonly used for transfection and expression of RXFP1 from various species. They provide a reliable system for functional cAMP assays to test receptor activation by different ligands . HEK293T cells have low background cAMP levels and show robust responses to forskolin (typically used as a positive control).

  • CHO cells: Chinese Hamster Ovary cells also provide a suitable expression system for RXFP1 studies, especially for stable transfection and long-term expression .

  • Specialized reporter systems: For higher sensitivity, cells can be co-transfected with CRE-reporter constructs like CRE-Luc BacMam, which allows detection of cAMP-dependent transcriptional activation through luciferase assays .

  • Expression tagging considerations: For studies requiring detection of surface expression, constructs with epitope tags (such as FLAG) can be used. This approach allowed researchers to confirm that both rabbit RXFP1 variants are expressed on the cell surface despite their inability to bind relaxin .

When designing expression constructs, it's important to ensure that the coding sequence is optimized for the host cell system and that appropriate regulatory elements are included. For comparative studies of receptors from different species, consistent expression levels should be verified, possibly through quantitative methods like flow cytometry of tagged receptors or Western blotting.

How can researchers assess Rxfp1 surface expression and binding in various experimental models?

Assessing Rxfp1 surface expression and binding involves several methodological approaches:

  • Epitope tagging: Adding epitope tags (such as FLAG) to the N-terminus of RXFP1 allows detection of surface expression using immunocytochemistry or flow cytometry with antibodies against the tag . This approach helped demonstrate that both rabbit RXFP1 splice variants were properly expressed on the cell surface despite their lack of response to relaxin peptides.

  • Fluorescently labeled ligand binding: Europium-labeled relaxin (Eu-labeled RLN) can be used to detect binding to surface-expressed receptors . The absence of binding of human Eu-labeled RLN to rabbit RXFP1 suggested that in this species, RXFP1 might be non-functional in terms of relaxin binding.

  • Quantitative RT-PCR: To assess transcript expression levels, quantitative reverse transcription PCR (qRT-PCR) with exon-spanning primers is effective. This technique was used to verify that the humanized RXFP1 allele in knock-in mice had similar tissue expression patterns to the native mouse Rxfp1 .

  • Functional assays as indirect measures: While not directly measuring surface expression, functional assays like cAMP production can serve as indirect indicators of functional receptor expression. These should be complemented with direct expression assessment methods for comprehensive characterization.

For in vivo models, assessing physiological responses to relaxin or ML290 (such as heart rate changes) can provide evidence of functional receptor expression, as demonstrated in the humanized RXFP1 mouse model .

What controls are essential when conducting Rxfp1 activation experiments?

When conducting Rxfp1 activation experiments, several controls are essential to ensure robust and interpretable results:

  • Positive controls:

    • Forskolin: A direct activator of adenylyl cyclase (typically used at 10 μM) serves as a positive control for cAMP production independent of receptor activation . Experimental responses are often normalized to forskolin stimulation.

    • Species-matched relaxin: Include known functional RXFP1-relaxin pairs (e.g., human RXFP1 with human relaxin) as positive controls when testing new receptor-ligand combinations.

  • Negative controls:

    • Vehicle controls: Dimethyl sulfoxide (DMSO) or other vehicles used for small molecule delivery should be tested to account for any non-specific effects .

    • Empty vector transfection: Cells transfected with empty vector help distinguish background responses from receptor-mediated effects.

    • Conditioned media controls: When testing secreted or conditioned media containing relaxin, media from cells transfected with empty vector serves as an appropriate control .

  • Specificity controls:

    • Known non-responsive receptor variants: Including receptor variants known not to respond to specific ligands (e.g., mouse Rxfp1 for ML290 experiments) helps confirm assay specificity.

    • Dose-response relationships: Testing a range of ligand concentrations allows determination of EC50 values and confirms specific receptor-mediated effects.

  • Experimental validation controls:

    • Multiple assay methods: When possible, confirm findings using different assay techniques (e.g., both direct cAMP measurement and reporter-based systems).

    • Biological replicates: Experiments should be repeated at least three times with triplicate measurements within each experiment .

Proper statistical analysis should be applied to determine significance, with p-values typically considered significant at p < 0.05 or lower thresholds for multiple comparisons.

How do activation patterns of Rxfp1 differ across mammalian species?

Activation patterns of Rxfp1 show significant species-specific variations across mammals:

  • Response to relaxin peptides:

    • Human, macaque, pig, and mouse RXFP1/Rxfp1: All show similar EC50 values when treated with porcine relaxin, indicating conservation of the relaxin response mechanism across these species .

    • Rabbit RXFP1: Notably, rabbit RXFP1 variants do not respond to human, pig, or mouse relaxin peptides (at 10 nM concentration), suggesting a major divergence in this species . The lack of binding of human Eu-labeled RLN to rabbit RXFP1 further supports this functional divergence.

    • Guinea pig RXFP1: Responds to relaxin but shows distinct pharmacological properties compared to other species .

  • Response to small molecule agonist ML290:

    • Human, macaque, and pig RXFP1: Strongly activated by ML290 .

    • Mouse and rat Rxfp1: Not activated by ML290 at physiologically relevant concentrations due to amino acid differences in the third extracellular loop (ECL) of the 7TM domain .

    • Guinea pig RXFP1: Shows very low response to ML290 only at the highest concentrations tested .

    • Rabbit RXFP1: Unlike other species patterns, rabbit RXFP1 variants are activated by ML290 but not by relaxin peptides .

These diverse activation patterns reflect evolutionary divergence in RXFP1 structure and function across mammalian species. Phylogenetic analysis shows primate and rodent RXFP1s grouped together, with pig RXFP1 situated between them, while rabbit RXFP1 is the most divergent . These differences necessitate careful consideration when selecting animal models for relaxin and RXFP1 modulator studies.

What physiological processes involving Rxfp1 are conserved versus divergent across species?

The physiological roles of Rxfp1 show both conservation and divergence across mammalian species:

  • Conserved physiological functions:

    • Reproductive processes: In females, RXFP1 function in relaxation of the pubic symphysis at parturition appears conserved. Humanized RXFP1 mice show normal pubic symphysis relaxation, suggesting functional complementation across species .

    • Reproductive tissue development: Development of mammary nipples and vaginal epithelium are RXFP1-dependent processes that appear conserved, as humanized RXFP1 mice show normal development of these tissues .

    • Cardiovascular effects: Relaxin's effect on increasing heart rate is conserved across species, occurring in both wild-type and humanized RXFP1 mice following relaxin administration .

  • Variable or divergent functions:

    • Receptor-ligand compatibility: Despite conservation of physiological roles, there are significant species differences in ligand recognition. Most notably, rabbit RXFP1 appears to be non-functional with respect to relaxin binding, suggesting potential evolutionary divergence in signaling mechanisms .

    • Response to pharmacological agents: The response to small molecule modulators like ML290 varies dramatically across species, with rodent receptors being non-responsive .

    • Osmoregulation: ML290 administration decreases blood osmolality in humanized RXFP1 mice, reflecting a physiological effect that may have species-specific manifestations .

How should researchers design cross-species comparative studies of Rxfp1?

Designing effective cross-species comparative studies of Rxfp1 requires careful consideration of several methodological aspects:

  • Selection of species:

    • Include evolutionary diverse species to capture phylogenetic variation (e.g., primates, rodents, lagomorphs).

    • Consider both closely related species pairs (e.g., human and macaque) and more distant relationships to understand conserved versus divergent features .

    • Based on existing data, macaque and pig models are suitable for ML290 testing, while rodent models require humanization for small molecule studies .

  • Molecular approaches:

    • Chimeric receptor constructs: Create chimeric receptors with swapped domains (extracellular or 7TM) between species to identify regions responsible for differential ligand responses . This approach successfully identified the third ECL as critical for ML290 activation.

    • Site-directed mutagenesis: Target specific amino acid differences between species to identify precise residues involved in ligand binding and activation .

    • Alternative splice variant analysis: Examine and compare species-specific splice variants, as observed in rabbit RXFP1 .

  • Functional characterization:

    • Standardized assay systems: Use consistent cell types, transfection methods, and assay conditions across species comparisons.

    • Multiple activation readouts: Assess cAMP production, ERK1/2 phosphorylation, and other downstream effects to capture potential signaling diversification .

    • Comprehensive ligand testing: Test multiple relaxin peptides from different species and small molecule modulators across concentration ranges .

  • In vivo validation:

    • Transgenic humanized models: For small molecule testing in rodents, create knock-in/knock-out models with human RXFP1 replacing the endogenous gene .

    • Physiological response measurements: Assess conserved parameters like heart rate changes to confirm functional conservation or divergence .

    • Multiple physiological readouts: Measure diverse parameters like osmolality, reproductive tissue development, and cardiovascular responses .

When reporting results, researchers should clearly specify the exact receptor variant, species source, expression system, and methodology to enable proper interpretation and comparison across studies.

What strategies are effective for cloning and expressing functional recombinant Rxfp1?

Effective strategies for cloning and expressing functional recombinant Rxfp1 include:

  • Source material selection:

    • Tissue selection: For cloning native Rxfp1, select tissues with high expression levels. Testis tissue has been successfully used for cloning rabbit and guinea pig RXFP1 .

    • Commercial cDNA libraries: These can provide reliable starting material for well-characterized species.

    • Synthetic gene synthesis: For difficult-to-obtain species or to introduce specific modifications, commercial gene synthesis offers a reliable alternative.

  • Cloning approaches:

    • RT-PCR based cloning: For native receptor cloning, design primers targeting conserved regions of RXFP1 based on multi-species sequence alignments .

    • Exon-spanning primers: These help ensure amplification of processed mRNA rather than genomic DNA contamination .

    • Alternative splicing considerations: Be aware of potential alternative splicing, as observed in rabbit RXFP1, and design strategies to capture all relevant variants .

  • Expression vector design:

    • Promoter selection: For mammalian expression, strong promoters like CMV are typically used.

    • Addition of epitope tags: N-terminal tags like FLAG can facilitate detection of surface expression without interfering with function .

    • Codon optimization: Consider codon optimization for the host expression system, especially for distant species.

  • Expression systems:

    • Transient transfection: HEK293T cells are commonly used for functional characterization due to low endogenous cAMP response and high transfection efficiency .

    • Stable cell lines: Consider developing stable cell lines for long-term studies requiring consistent expression levels.

    • Verification methods: Employ RT-PCR or qRT-PCR to confirm transcript expression .

  • Functional validation:

    • Surface expression verification: Confirm proper receptor localization to the plasma membrane using tagged constructs .

    • Ligand binding assays: Verify binding capability using labeled ligands like Eu-labeled relaxin .

    • Signal transduction assays: Confirm functional coupling to G proteins through cAMP or other relevant signaling readouts .

For chimeric receptors, carefully design junction points at conserved regions to maintain proper protein folding and function, as successfully demonstrated in studies with human-rabbit and human-guinea pig RXFP1 chimeras .

How can researchers optimize transfection and expression of Rxfp1 for functional studies?

Optimizing transfection and expression of Rxfp1 for functional studies requires attention to several key factors:

  • Transfection optimization:

    • Cell density: Transfect cells at 70-80% confluence for optimal balance between transfection efficiency and cell health.

    • Transfection reagent selection: Compare lipid-based reagents (e.g., Lipofectamine), calcium phosphate, and electroporation to determine the best method for your specific cell type.

    • DNA quality and quantity: Use high-purity plasmid DNA (A260/A280 > 1.8) and optimize the DNA:transfection reagent ratio.

    • Incubation time: Allow 24-48 hours post-transfection for optimal protein expression before conducting functional assays .

  • Expression verification methods:

    • Western blotting: For total protein expression quantification (less relevant for membrane proteins).

    • Flow cytometry: For epitope-tagged receptors, quantify surface expression levels across cell populations.

    • Immunocytochemistry: Visualize receptor localization to confirm proper trafficking to the plasma membrane.

    • Functionality testing: Measure cAMP responses to known agonists like relaxin as an indirect measure of functional expression .

  • Co-transfection considerations:

    • Reporter constructs: When co-transfecting with reporter systems like CRE-Luc, optimize the ratio of receptor to reporter construct.

    • Internal controls: Include transfection efficiency controls such as constitutively expressed fluorescent proteins.

  • Expression enhancement strategies:

    • Sodium butyrate: Addition of sodium butyrate (1-5 mM) 24 hours post-transfection can enhance protein expression in some systems.

    • Temperature adjustment: Incubation at lower temperature (30-35°C) after transfection can improve folding of some difficult-to-express proteins.

    • Inclusion of chaperones: Co-expression with molecular chaperones may improve folding and trafficking of challenging receptor variants.

  • Assay timing optimization:

    • Expression kinetics: Determine the optimal time window post-transfection for peak receptor expression and functionality.

    • Signal detection timing: For cAMP assays, optimize stimulation time (typically 2 hours for CRE-Luc assays ) to capture maximal responses.

For comparative studies of different Rxfp1 variants, it's crucial to normalize expression levels across constructs, either by adjusting DNA amounts or by normalizing functional responses to receptor expression levels determined by flow cytometry or other quantitative methods.

What are the key considerations for selecting appropriate models for Rxfp1 research?

The selection of appropriate models for Rxfp1 research requires careful consideration of several key factors:

  • Research objective alignment:

    • Relaxin peptide studies: Most mammalian RXFP1s respond to relaxin, making many species suitable, though with varying potencies .

    • Small molecule modulator studies: For ML290 and related compounds, human, macaque, and pig RXFP1 are suitable, while mouse and rat Rxfp1 are not responsive . Humanized mouse models offer a solution for in vivo testing .

    • Basic receptor biology: Consider using multiple species to identify conserved versus divergent features, with rabbit RXFP1 providing an interesting counterpoint as it responds to ML290 but not relaxin .

  • Species-specific considerations:

    • Primates: Human and macaque RXFP1 show similar pharmacological profiles, making macaques suitable for translational studies .

    • Pigs: Pig RXFP1 responds to both relaxin and ML290, offering a large animal model option .

    • Rodents: Native mouse and rat Rxfp1 are not suitable for ML290 studies, necessitating humanized models .

    • Rabbits: The unique pharmacological profile of rabbit RXFP1 (ML290-responsive but relaxin-unresponsive) makes it unsuitable for most translational studies but valuable for structure-function investigations .

    • Guinea pigs: Limited ML290 response makes guinea pig RXFP1 less suitable for small molecule testing .

  • Experimental system selection:

    • In vitro cell models: HEK293T cells provide a reliable system for transfection and functional characterization of various RXFP1 constructs .

    • Transgenic models: Humanized RXFP1 mice with human RXFP1 cDNA knocked into the mouse Rxfp1 locus offer an excellent system for in vivo testing of human-specific compounds .

    • Ex vivo tissue preparations: These can bridge the gap between cellular systems and whole animals.

  • Validation requirements:

    • Expression verification: Confirm receptor expression through RT-PCR, qRT-PCR, or epitope tag detection .

    • Functional testing: Validate receptor functionality through appropriate ligand responses (relaxin for most species, ML290 for human, macaque, pig, and rabbit RXFP1) .

    • Physiological relevance: Verify that model systems reproduce relevant physiological responses, such as heart rate changes or osmolality effects .

Based on the available data, macaque and pig models emerge as most suitable for translational studies of ML290 and related compounds, while humanized RXFP1 mice provide a valuable rodent model for in vivo testing .

What emerging technologies might advance Rxfp1 research in the near future?

Several emerging technologies hold promise for advancing Rxfp1 research in the near future:

  • CRISPR/Cas9 gene editing applications:

    • Precise receptor humanization: Beyond full receptor replacement, creating specific human-like modifications at key residues in the mouse Rxfp1 7TM domain might produce more nuanced models for structure-function studies.

    • Conditional knockout/knockin models: Tissue-specific or inducible expression of human RXFP1 could help dissect organ-specific functions.

    • Reporter knock-ins: Inserting fluorescent or luminescent reporters downstream of the RXFP1 promoter could enable real-time monitoring of receptor expression.

  • Advanced structural biology techniques:

    • Cryo-electron microscopy: This could resolve the complete structure of RXFP1 in various ligand-bound states, providing critical insights into the mechanisms of activation by both peptides and small molecules.

    • Hydrogen-deuterium exchange mass spectrometry: This approach could characterize conformational changes upon ligand binding, particularly useful for comparing relaxin versus ML290 interactions.

    • Single-molecule FRET: This could track receptor conformational dynamics in real-time, revealing activation mechanisms.

  • Drug discovery technologies:

    • Structure-based drug design: With better structural information, computational approaches could develop improved small molecule modulators with tailored species specificity or signaling bias.

    • Bispecific/engineered ligands: Creating chimeric ligands combining elements of relaxin and small molecules might yield novel activation properties.

    • Allosteric modulator development: The distinct binding sites for relaxin and ML290 suggest opportunities for developing allosteric modulators with unique pharmacological properties.

  • Advanced in vivo imaging:

    • PET ligands for RXFP1: Development of positron emission tomography ligands specific for RXFP1 could enable non-invasive visualization of receptor distribution and occupancy.

    • Optogenetic/chemogenetic control: Engineering light or designer drug-responsive RXFP1 variants could enable precise temporal control of receptor activation in vivo.

  • Systems biology approaches:

    • Multi-omics profiling: Comprehensive characterization of transcriptomic, proteomic, and metabolomic responses to RXFP1 activation across species could reveal conserved versus divergent signaling networks.

    • Single-cell analysis: Examining RXFP1 expression and responses at single-cell resolution could uncover previously unrecognized heterogeneity in receptor function.

These emerging technologies would complement the foundational work on humanized RXFP1 mouse models and cross-species comparisons , potentially accelerating translational applications of RXFP1 modulators for conditions like heart failure, where relaxin has shown therapeutic promise .

What are the most promising therapeutic applications emerging from Rxfp1 research?

The most promising therapeutic applications emerging from Rxfp1 research span several medical domains:

  • Cardiovascular applications:

    • Acute heart failure: Relaxin peptide has shown therapeutic effects in acute heart failure clinical trials , and small molecule RXFP1 agonists like ML290 could provide more practical alternatives with improved pharmacokinetic properties.

    • Cardiac remodeling: RXFP1 activation influences cardiac remodeling processes, suggesting potential applications in preventing adverse remodeling after myocardial infarction.

    • Vascular function: The effect of RXFP1 activation on heart rate and other vascular parameters suggests potential applications in hypertension and vascular compliance disorders.

  • Fibrotic disorders:

    • Liver fibrosis: RXFP1 activation has antifibrotic effects that could be therapeutically valuable in liver fibrosis and cirrhosis.

    • Pulmonary fibrosis: Small molecule RXFP1 agonists might benefit patients with idiopathic pulmonary fibrosis, a condition with limited treatment options.

    • Renal fibrosis: The antifibrotic and hemodynamic effects of RXFP1 activation make it a potential target for chronic kidney disease.

  • Reproductive medicine:

    • Pregnancy complications: Given RXFP1's role in pubic symphysis relaxation during parturition , modulators might help manage certain pregnancy complications.

    • Preterm labor: Understanding RXFP1's role in reproductive tissues might lead to therapies for preventing preterm birth.

  • Metabolic regulation:

    • Osmoregulation: The observed effects of ML290 on decreasing blood osmolality in humanized mice suggest applications in disorders of fluid homeostasis.

    • Glucose metabolism: Emerging evidence links RXFP1 signaling to metabolic regulation, potentially relevant for diabetes and obesity.

  • Combination therapies:

    • Small molecule/peptide combinations: The distinct binding sites and activation mechanisms for relaxin versus ML290 create opportunities for combination therapies with synergistic effects.

    • Adjunctive therapy: RXFP1 modulators might enhance the efficacy of existing treatments for heart failure, fibrosis, or other conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.