Recombinant Mouse Relaxin receptor 2 (Rxfp2)

Shipped with Ice Packs
In Stock

Description

Mechanistic Insights

  • Activation pathways:

    • INSL3 binding: Induces conformational reorientation of the LDLa module, activating transmembrane domains (TMDs) via cAMP signaling .

    • Relaxin cross-reactivity: Human H2 relaxin weakly activates mouse RXFP2 via LDLa-linker interactions, unlike species-specific relaxins (e.g., mouse relaxin) .

  • Mutagenesis studies:

    • Mutations in the GDxxGW motif (e.g., D42A, G45A, W46A) reduce INSL3- and relaxin-induced cAMP production by >80% .

    • The linker region is dispensable for INSL3 binding but essential for relaxin interaction .

Physiological Roles

  • Testicular descent: RXFP2 knockout mice exhibit cryptorchidism due to impaired gubernacular ligament development .

  • Bone metabolism: RXFP2 activation increases osteoblast mineralization in vitro and improves trabecular bone parameters in vivo .

  • Muscle maintenance: Rxfp2-deficient mice show exacerbated muscle loss under oxidative stress .

Small Molecule Agonists

Recent studies identified orally bioavailable RXFP2 agonists with therapeutic potential:

CompoundEfficacy (cAMP)Species Cross-ReactivityIn Vivo Effect
6641Full agonistHuman, Mouse Gubernacular invagination, improved bone density
4337Partial agonistHuman Osteoblast mineralization
4340Partial agonistHuman Reduced muscle atrophy

Recombinant Protein Properties

ParameterDetailSource
Host systemE. coli, mammalian cells, baculovirus
Purity≥85% (SDS-PAGE verified)
ApplicationsLigand binding assays, Western blotting
Species variantsMouse, dog isoforms available

Therapeutic Implications

  • Bone disorders: RXFP2 agonists enhance osteoblast activity, offering potential for osteoporosis treatment .

  • Hypogonadism: Targeting RXFP2 may counteract muscle wasting linked to testosterone deficiency .

  • Fibrosis modulation: Relaxin/RXFP2 signaling reduces TGF-β1 levels in bladder smooth muscle cells .

Limitations and Future Directions

  • Species specificity: Murine RXFP2 agonists (e.g., compound 6641) show divergent efficacy in human versus mouse receptor assays .

  • Structural dynamics: Full-length receptor crystallization remains challenging, limiting atomic-level mechanistic insights .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary based on the purchasing method or location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipment is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
Rxfp2; Gpr106; Great; Lgr8; Relaxin receptor 2; G-protein coupled receptor 106; G-protein coupled receptor affecting testicular descent; Leucine-rich repeat-containing G-protein coupled receptor 8; Relaxin family peptide receptor 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-737
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MWLLLHVILLTEVKDFALADSSMVAPLCPKGYFPCGNLTKCLPRAFHCDGVDDCGNGADE DNCGDTSGWTTIFGTVHGNVNKVTLTQECFLSQYPQHCYCRENELECVKADLKAVPKVSS NVTLLSLKKNKIHRLPVKVFSRYTELRKIYLQHNCITHISRRAFLGLHNLQILYLSHNCI TSLRPGIFKDLHQLAWLILDDNPITRISQKSFMGLNSLFFLSMVGNRLEALPETLCAQMP QLNWVDLANNGIKYITNSTFLTCDSLTVLFLPRNQIGFVPEKTFSSLKNLGELDLSSNMI TKLPVHLFSDLHLLQKLNLSSNPLLYVHKNQFGSLKQLQSLDLERIEIPNISTGMFQPMK NLSHIYLKTFRYCSYVPHVRICMPSTDGISSSEDLLANGILRVSVWVIAFITCVGNFLVI AVRSLIKAENTTHAMSIKILCCADCLMGVYLFSVGVFDIKYRGQYQKYALLWMESVPCRL LGFLATLSTEVSVLLLTFLTLEKFLVIVFPFSNLRLGKRQTAVALASIWVVGFLIAAVPF TREDYFGNFYGKNGVCFPLHYDQAEDFGSRGYSLGIFLGVNLLAFLVIVISYVTMFCSIH KTALQTAEVRSHIGKEVAVANRFFFIVFSDAICWIPVFVVKILSLLQVEIPGTITSWIVV FFLPVNSALNPILYTLTTSFFKDKLKQLLHKHRRKPIFKVKKKSLSASIVWTDESSLKLG VLSKIALGDSIMKPVSP
Uniprot No.

Target Background

Function
Relaxin receptor 2 (RXFP2) is a receptor for relaxin. Its activity is mediated by G proteins, leading to stimulation of adenylate cyclase and an increase in cAMP levels. It may also serve as a receptor for Leydig insulin-like peptide (INSL3).
Gene References Into Functions
  1. Loss of function of Lgr6 did not impact epidermal cell proliferation, cell migration, or wound healing. PMID: 27579888
  2. Findings suggest that DES (diethylstilbestrol) causes testicular maldescent by altering the LGR8 pathway in mouse gubernaculum testis cells. PMID: 26855023
  3. Results demonstrated that INSL3 altered RXFP2 expression in mouse gubernaculum testis cells in vitro. PMID: 26823808
  4. Data suggests a novel role for Rln (relaxin) in craniofacial skeletal development and metabolism through Rxfp2. PMID: 24857857
  5. Rxfp1, Rxfp2, and Nr3c1 mRNAs were expressed in the developing maxilla and mandible, Meckel's cartilage, tongue, and tooth primordia between mouse embryonic days 13.5-18.5. PMID: 24370181
  6. Spermatogonial stem cells undergo significant depletion in the cryptorchid testes of RXFP2 deficient mice. PMID: 24098584
  7. Data indicates that Insl3/Rxfp2 (insulin-like peptide 3/relaxin receptor 2) signaling plays a crucial role in testicular descent; however, germ-cell deletion of Rxfp2 did not affect spermatogenesis, germ cell survival, or male fertility. PMID: 23100620
  8. Prenatal exposure to diethylstilbestrol increased the expression of LGR8 mRNA in the mouse gubernaculum testis. PMID: 22934511
  9. A deficiency of Rxfp2 on a Cav1-deficient background resulted in a greater than 2-fold increase in the incidence of uterine cysts. PMID: 21467199
  10. A mouse model was created with a novel missense mutation in Relaxin/insulin-like family peptide receptor 2, likely preventing binding to its ligand, Insulin-like peptide 3, leading to failure of the transabdominal phase of testicular descent. PMID: 20963592
  11. The RXFP2 signaling pathway plays a significant role in mediating androgen action to stimulate gubernaculum development during inguinoscrotal testis descent. PMID: 20154177
  12. Insulin-like 3 peptide is a major cause of cryptorchidism (undescended testes) in mice. PMID: 12933905
  13. Disruption of the Great gene leads to failure of the transabdominal phase of descent, similar to the Insl3-deficient mutants, supporting recent data suggesting that the Great gene encodes the Insl3 transmembrane receptor. PMID: 14666470
  14. Neither Insl3 nor Lgr8 contribute to the RLN signaling pathway; Insl3/Lgr8 and Rln1/Lgr7 actions do not overlap in vivo. PMID: 15256493
  15. Rxfp2 gene expression at different stages of embryonic and postnatal mouse development in male reproductive tissues was examined. PMID: 17615407
  16. Rxfp2-deficient mice exhibited decreased bone mass, mineralizing surface, bone formation, and osteoclast surface. PMID: 19416191
  17. Data suggests that Pod1 may negatively regulate Rxfp2 expression in the developing glomerulus to promote cell proliferation. PMID: 19416211

Show More

Hide All

Database Links
Involvement In Disease
Defects in Rxfp2 seems to be a cause of impaired testicular descent (known as cryptorchidism).
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in embryonic and adult gonads of males and females, as well in male gubernarculum. Expressed also in brain. Not detected in kidney, spleen and heart.

Q&A

What is Rxfp2 and what is its primary ligand?

Rxfp2 (Relaxin Family Peptide Receptor 2) is a rhodopsin-like G protein-coupled receptor that primarily serves as the receptor for Insulin-like peptide-3 (INSL3). It exhibits structural homology with RXFP1, with mouse RXFP1 showing approximately 89% identity to human RXFP1 . Unlike many GPCRs, RXFP2 demonstrates constitutive activity, meaning it can signal in the absence of ligand stimulation . This receptor is crucial for the first stage of testis descent and has been implicated in bone metabolism and cancer development in tissues such as the thyroid and prostate .

How does Rxfp2 compare structurally to other relaxin family receptors?

Rxfp2 belongs to the relaxin family peptide receptor group but has distinct structural features. It shares significant homology with RXFP1, the primary receptor for relaxin-2, but maintains ligand specificity. The binding of ligands to RXFP receptors involves high-affinity interaction with the extracellular domain containing leucine-rich repeats (LRRs) and an additional binding site in the transmembrane exoloops . These structural characteristics allow for specific ligand recognition while maintaining the core GPCR functionality. The constitutive activity observed in RXFP2 mirrors that seen in RXFP1, suggesting conserved activation mechanisms between these related receptors .

What signaling pathways are activated by Rxfp2?

Rxfp2 primarily signals through the cAMP pathway. When expressed in HEK293 cells, human RXFP2 exhibits strong agonist-independent increases in intracellular cAMP levels, with basal cAMP production approximately 13.5±1.2 fold higher than in control cells . This constitutive activity accounts for about 60±1.8% of the maximal response to INSL3 . The signaling capacity of RXFP2 is directly proportional to its expression level, as demonstrated by cDNA-dosing experiments showing linear increases in cAMP production with increasing amounts of RXFP2 . Additionally, RXFP2 can potentiate forskolin-induced cAMP production, further confirming its constitutive activity .

What are the recommended cell models for studying Rxfp2 function?

For investigating Rxfp2 function, multiple cellular models have proven effective. HEK293 cells transiently transfected with human RXFP2 (hRXFP2) provide a reliable system for measuring receptor activity through intracellular cAMP production . COS-7 cells have also been validated as an alternative model system for RXFP2 studies . For high-throughput screening applications, HEK293 cells transduced with RXFP2 via baculovirus-mediated gene transfer (BacMam) have been successfully employed . When designing experiments, it's critical to include appropriate controls such as empty vector transfections (e.g., pcDNA3.1Zeo) to accurately assess ligand-independent signaling . For more physiologically relevant studies, researchers should consider models with endogenous RXFP2 expression, though validating receptor levels in these systems is essential.

How can I measure Rxfp2 activation in experimental settings?

Multiple methodological approaches can effectively measure Rxfp2 activation:

  • cAMP Assays: The primary readout for RXFP2 activation involves measuring intracellular cAMP levels. This can be accomplished using IBMX (a phosphodiesterase inhibitor) to prevent cAMP degradation, followed by quantification via enzyme immunoassay or homogenous time-resolved fluorescence (HTRF) .

  • Functional Potentiation: Measuring RXFP2's ability to potentiate forskolin-induced cAMP production provides another approach to confirm constitutive activity .

  • cDNA-Dosing Experiments: Transfecting increasing amounts of RXFP2 cDNA while measuring corresponding cAMP levels can demonstrate the receptor's intrinsic activity and expression-dependent signaling .

  • RT-PCR Analysis: For tissue or organ culture studies, measuring Rxfp2 mRNA levels via RT-PCR can assess receptor expression in response to treatments. Semi-quantitative or quantitative RT-PCR can detect changes in expression, as demonstrated in studies of androgen-induced gubernacular Rxfp2 expression .

What controls are essential when studying Rxfp2's constitutive activity?

  • Empty Vector Controls: Cells transfected with the empty vector (e.g., pcDNA3.1Zeo) provide the baseline for comparing agonist-independent activity .

  • INSL3 Stimulation: Including INSL3 stimulation allows calibration of constitutive activity against maximal receptor response .

  • Ligand Production Verification: RT-PCR should be performed to rule out local production of INSL3 that might skew results of ligand-independent activation studies .

  • Forskolin Controls: Using forskolin stimulation helps distinguish receptor-mediated cAMP increases from other cellular mechanisms affecting cAMP levels .

  • Phosphodiesterase Inhibition: Including IBMX treatment ensures cAMP accumulation by preventing degradation, providing a more accurate measurement of production rates .

How is Rxfp2 expression regulated by hormonal factors?

Rxfp2 expression demonstrates significant hormonal regulation, particularly by androgens. In gubernaculum organ cultures from 22-day-old wild-type mice, treatment with 5α-dihydrotestosterone (DHT) increases Rxfp2 mRNA levels in a time-dependent manner, with maximal stimulation observed at 2×10^-6 M DHT after 12 hours of incubation . This regulation occurs in vivo as well. Studies using luteinizing hormone receptor knockout (LhrKO) mice demonstrate dramatically decreased Rxfp2 mRNA levels that can be restored by testosterone replacement therapy . Acute androgen effects on Rxfp2 expression have been observed in 30-day-old LhrKO mice given a single injection of testosterone propionate (TP), with significant increases in gubernacular Rxfp2 mRNA levels at 24 hours post-injection compared to vehicle-treated controls . These findings establish a clear hormonal regulatory mechanism for Rxfp2 expression that may be critical for its physiological functions.

What is the role of Rxfp2 in testicular descent, and how has this been experimentally demonstrated?

Rxfp2 plays a critical role in the first phase of testicular descent, as demonstrated through both genetic and pharmacological approaches. The receptor's activation by its cognate ligand INSL3 is necessary for proper gubernacular development and the initial transabdominal phase of testis descent . In vivo studies using LhrKO mice have shown that decreased androgen levels lead to reduced Rxfp2 expression in the gubernaculum, which can be restored with testosterone replacement therapy . The mechanistic connection between androgen levels, Rxfp2 expression, and gubernacular development provides a model for understanding cryptorchidism (undescended testes). Researchers have validated this pathway by demonstrating that gubernacular organ cultures respond to DHT with increased Rxfp2 mRNA expression in a time-dependent manner . These experiments collectively establish that Rxfp2 serves as a critical intermediary between androgenic hormonal signals and the physical process of testicular descent during development.

What are the key differences between RXFP1 and RXFP2 in terms of ligand specificity and signaling outcomes?

While RXFP1 and RXFP2 share structural homology and both exhibit constitutive activity, they differ significantly in ligand specificity and downstream signaling outcomes:

FeatureRXFP1RXFP2
Primary LigandRelaxin-2Insulin-like peptide-3 (INSL3)
Secondary Ligand BindingCan bind INSL3 with lower affinityMinimal binding to relaxin-2
G-protein CouplingPrimarily Gαs and Gαi2Predominantly Gαs
Constitutive ActivityPresent (~60% of maximum)Present (~60% of maximum)
Vasodilatory EffectsPronounced (via Gαi2-PI3K-eNOS pathway)Limited
β-arrestin RecruitmentLimited without GRK2 overexpressionNot well characterized

RXFP1 activation by relaxin-2 induces endothelium- and NO-dependent relaxation of mouse mesenteric arteries through the Gαi2-PI3K-eNOS pathway . Studies using Gαi2-deficient (Gnai2-/-) mice showed impaired relaxin-2-induced vasodilation, while Gαi3-deficient (Gnai3-/-) mice maintained normal responses, indicating selective G-protein coupling preferences . These distinctive signaling properties suggest that despite structural similarities, RXFP1 and RXFP2 likely evolved to serve different physiological functions with specific signaling outcomes.

How can I develop and validate antagonists for Rxfp2 in my research?

Developing and validating Rxfp2 antagonists requires a systematic approach:

  • Assay Development: Establish a robust high-throughput screening (HTS) assay using HEK293 cells expressing RXFP2. Successful approaches have employed baculovirus-mediated gene transfer (BacMam) for consistent expression .

  • Screening Protocol: Implement a primary, single-shot antagonist screen (typically at 10 μM) followed by confirmation of "hits" using 11-point dose-response curves with 1:3 dilutions from 100 μM .

  • Detection Method: Homogenous time-resolved fluorescence (HTRF) has proven effective for detecting compound inhibition of INSL3-induced cAMP production in RXFP2-expressing cells .

  • Compound Selection Considerations: Be aware that previous screening campaigns have identified a tendency toward lipophilic, poorly soluble compounds with property forecast index (PFI) values greater than 6, indicating potentially poor drug developability outcomes . Consider this bias when evaluating hits.

  • Epitope Mapping: For antibody-based antagonists, conduct bead-based high-throughput epitope binning experiments to understand the diversity of epitopes covered by antibodies targeting RXFP2 .

  • Validation in Multiple Systems: Test promising antagonists in multiple cell systems, including those with endogenous RXFP2 expression, to confirm specificity and effectiveness.

What approaches have been successful in engineering long-acting Relaxin receptor ligands?

Engineering long-acting Relaxin receptor ligands has been successfully accomplished through protein fusion strategies. For relaxin-2, which has a very short serum half-life limiting its clinical applications , researchers have developed optimized fusions between the hormone and antibody Fc fragments . These engineering efforts successfully:

  • Increased serum half-life while maintaining receptor activation capacity

  • Generated fusion proteins with circulating half-lives of 3-5 days in mice compared to the very short half-life of the native hormone

  • Retained potent agonist activity at the receptors both in vitro and in vivo

A specifically optimized molecule, AZD3427, consisting of heterodimeric Fc and one copy of relaxin-2, effectively stimulated cAMP production in cells expressing recombinant RXFP1 from human, mouse, or cynomolgus monkey sources . While the potency was somewhat reduced compared to the native hormone, the specificity for RXFP1 over RXFP2 matched that of native relaxin-2 . AZD3427 demonstrates superior physicochemical properties and stability, resulting in extended half-lives across multiple species: mouse, rat, and lean cynomolgus monkey . In non-human primates, AZD3427 exhibited a half-life of 112-120 hours, allowing for once-weekly subcutaneous dosing .

How can I investigate the role of Rxfp2's constitutive activity in specific tissues?

Investigating Rxfp2's constitutive activity in specific tissues requires a multifaceted approach:

  • Tissue-Specific Expression Analysis: First, characterize endogenous Rxfp2 expression in target tissues using quantitative RT-PCR and immunohistochemistry to establish baseline expression patterns.

  • Ex Vivo Tissue Culture Systems: Develop organ or tissue culture systems (similar to the gubernacular organ cultures described in the literature ) to measure cAMP production in the absence and presence of INSL3, with appropriate phosphodiesterase inhibition.

  • Genetic Approaches: Design tissue-specific knockdown or overexpression studies using viral vectors or tissue-specific promoters to modulate Rxfp2 levels in specific tissues. Monitor corresponding changes in baseline cAMP levels and downstream signaling.

  • Pharmacological Intervention: Apply small molecule RXFP2 antagonists identified through high-throughput screening to assess their impact on baseline signaling in tissues with endogenous Rxfp2 expression.

  • Transgenic Models: Consider developing conditional knockout or knockin mouse models with mutations affecting constitutive activity but preserving ligand response to distinguish between ligand-dependent and independent functions.

  • Downstream Signaling Analysis: Examine phosphorylation states of key signaling molecules (e.g., ERK, Akt) in tissues with varying Rxfp2 expression levels to characterize tissue-specific constitutive signaling outcomes.

What experimental approaches can resolve contradictory findings regarding Rxfp2-mediated signaling?

Resolving contradictory findings in Rxfp2-mediated signaling requires systematic investigation:

  • Species-Specific Differences: Human RXFP2 shows 89% identity to mouse RXFP1 , suggesting potential interspecies variations. Conduct parallel experiments in both human and mouse systems to identify species-specific signaling differences.

  • Expression Level Dependence: Since cAMP production increases linearly with RXFP2 expression levels , quantify receptor expression in all experimental systems and normalize signaling responses accordingly.

  • G-Protein Subtype Analysis: Based on findings that RXFP1 couples preferentially to Gαi2 rather than Gαi3 , investigate specific G-protein coupling preferences for RXFP2 using cells from Gα-protein subtype knockout mice.

  • Signal Pathway Isolation: Employ specific pathway inhibitors (e.g., PI3K inhibitors, Akt inhibitors) to dissect which contradictory findings might result from measuring different branches of complex signaling networks.

  • Temporal Resolution: Conduct time-course experiments to determine whether apparent contradictions reflect differences in early versus late signaling events rather than fundamentally different pathways.

  • Cell Type Dependence: Compare signaling in multiple cell types, as RXFP1/RXFP2 signaling may differ between HEK293, COS-7, and cells with endogenous receptor expression .

How can I design experiments to explore crosstalk between Rxfp2 and other signaling systems?

Designing experiments to explore crosstalk between Rxfp2 and other signaling systems requires careful consideration of multiple experimental approaches:

  • Co-immunoprecipitation Studies: Identify physical interactions between Rxfp2 and components of other signaling systems through co-immunoprecipitation followed by mass spectrometry or Western blotting.

  • BRET/FRET Analysis: Utilize bioluminescence/fluorescence resonance energy transfer techniques to visualize real-time interactions between Rxfp2 and potential signaling partners in living cells.

  • Dual Receptor Activation: Stimulate cells expressing Rxfp2 with INSL3 in combination with ligands for other receptors to detect synergistic or antagonistic effects on downstream signaling.

  • Pathway Inhibitor Matrix: Create a matrix of specific pathway inhibitors to systematically block components of potentially interacting pathways while monitoring Rxfp2 signaling outcomes.

  • Gene Expression Analysis: Perform RNA-seq or proteomics on cells with activated Rxfp2 to identify changes in expression of other signaling system components, suggesting potential regulatory crosstalk.

  • Mathematical Modeling: Develop computational models incorporating experimental data to predict and test hypotheses about signaling network interactions involving Rxfp2.

  • Conditional Knockouts: Generate cell lines or animal models with inducible knockdown/knockout of suspected crosstalk partners to evaluate their necessity for specific Rxfp2 signaling outcomes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.