Recombinant Mouse Reprimo-like protein (Rprml)

Shipped with Ice Packs
In Stock

Description

Reprimo Gene Family Classification

The Reprimo gene family consists of two primary members: Reprimo (RPRM) and Reprimo-like (RPRML). While RPRM has been well-characterized as a p53-dependent mediator of cell cycle regulation, RPRML remains relatively uncharacterized despite showing significant homology to its better-studied counterpart. The Reprimo-like gene (RPRML) has been identified as an uncharacterized member of this gene family with potential tumor suppressor capabilities .

Subcellular Localization

The subcellular localization of Rprm (Reprimo) has been identified as cytoplasmic and membrane-associated, classified specifically as a single-pass membrane protein . Given the homology between Rprm and Rprml, it is reasonable to infer that Rprml may share similar localization patterns, though this remains to be conclusively demonstrated through focused research on Rprml specifically.

Cell Cycle Regulation

Research on the Reprimo family indicates a critical role in cell cycle regulation, particularly at the G2/M checkpoint. RPRML has been shown to induce cell cycle arrest, with experimental evidence demonstrating that RPRML overexpression reduces cell proliferation by arresting the cell cycle at the G2/M phase . This function appears similar to that of RPRM, which has been shown to be involved in the regulation of p53-dependent G2 arrest of the cell cycle .

Tumor Suppressor Activity

Compelling experimental evidence supports RPRML's role as a tumor suppressor. Studies involving the overexpression of RPRML in the AGS gastric cancer cell line demonstrated significant inhibition of clonogenic capacity and anchorage-independent growth, fundamental hallmarks of cancer cells . Furthermore, RPRML overexpression significantly reduced cell proliferation as measured by the MTS assay at 24h, 48h, and 72h after cell seeding, providing strong evidence for its anti-proliferative function .

Molecular Mechanisms

The mechanism by which RPRML exerts its tumor suppressor function appears to involve cell cycle arrest at the G2/M phase. This mechanism is likely similar to that of RPRM, which induces cell cycle arrest by inhibiting CDK1 activity and nuclear translocation of the CDC2 cyclin B1 complex . Cell cycle progression analysis suggests that RPRML's reduction in proliferation may be due specifically to an arrest in G2/M, further supporting its role in cell cycle regulation .

Epigenetic Regulation

Evidence suggests that RPRML expression may be regulated through epigenetic mechanisms, particularly DNA methylation. Research on human RPRML has shown that DNA methylation-mediated silencing can be a mechanism controlling its expression, as demonstrated by 5-azacytidine assays and direct bisulfite sequencing . Whether similar regulatory mechanisms apply to mouse Rprml remains to be determined through dedicated research.

Production and Characterization

The production of recombinant mouse Rprml would typically involve expressing the gene in suitable host systems followed by protein purification. While detailed protocols specifically for recombinant mouse Rprml production are not extensively documented in the current literature, similar approaches to those used for related proteins could be adapted. Standard recombinant protein production techniques, including bacterial, yeast, or mammalian expression systems, followed by affinity chromatography purification, would likely be applicable.

Research Applications

Recombinant mouse Rprml would have numerous valuable applications in research, including:

  1. Structural studies to characterize protein domains and interaction surfaces

  2. Development of specific antibodies for detection of endogenous Rprml

  3. Investigation of protein-protein interactions and signaling pathways

  4. Functional assays to elucidate mechanisms of action

  5. Screening of compounds that modulate Rprml function for potential therapeutic applications

Detection Methods

Currently, commercial tools specifically designed for mouse Rprml research appear limited. Related research tools include the Mouse Protein reprimo (Rprm) ELISA Kit, which allows for the precise measurement of Reprimo levels in mouse samples including serum, plasma, and cell culture supernatants . This kit demonstrates high sensitivity (0.091ng/mL) and specificity for mouse Reprimo, with a detection range of 0.156-10ng/mL . Development of similar tools specifically for Rprml would significantly advance research in this area.

Experimental Models

The development of experimental models with altered Rprml expression would be valuable for investigating its function. These could include cell lines with Rprml overexpression or knockdown, as well as transgenic mouse models. Such models would facilitate in-depth studies of Rprml's role in normal development, physiology, and disease states.

Therapeutic Implications

Given its tumor suppressor function, strategies to restore or enhance RPRML expression or activity could represent promising therapeutic approaches for cancer treatment. Further research on recombinant mouse Rprml could contribute to the development of such strategies, potentially leading to novel cancer therapies.

Comparison of Reprimo Family Proteins

The following table summarizes key comparative features of the Reprimo protein family members:

FeatureRPRMRPRML
FunctionRegulation of p53-dependent G2 arrestCell cycle arrest at G2/M phase
MechanismInhibits CDK1 activity and CDC2-cyclin B1 complex translocationSimilar mechanism, reduces cell proliferation
Subcellular LocationCytoplasm, Membrane (single-pass)Likely similar to RPRM (inferred)
Role in CancerTumor suppressorTumor suppressor, downregulation linked to poor prognosis
Detection Range (ELISA)0.156-10ng/mLNot specified
Sensitivity (ELISA)0.091ng/mLNot specified

Experimental Evidence for RPRML Function

Key experimental findings supporting RPRML's biological functions include:

Experimental ApproachFindingSignificance
Overexpression in AGS cell lineReduced clonogenic capacity and anchorage-independent growthConfirms tumor suppressor properties
MTS assayReduced cell proliferation at 24h, 48h, and 72hDemonstrates anti-proliferative effect
Ki67 immunofluorescenceSignificant reduction in Ki67-positive cellsValidates decreased proliferation capacity
Cell cycle analysisArrest in G2/M phaseIdentifies mechanism of growth inhibition

Knowledge Gaps and Research Priorities

Significant gaps remain in our understanding of mouse Rprml, presenting several priority areas for future research:

  1. Detailed molecular structure determination through crystallography or cryo-EM

  2. Comprehensive characterization of tissue-specific expression patterns

  3. Identification of regulatory mechanisms controlling Rprml expression

  4. Complete mapping of protein interaction networks

  5. Development of specific antibodies and detection methods for mouse Rprml

  6. Creation of transgenic mouse models with altered Rprml expression

Emerging Technologies and Approaches

Advanced technologies that could accelerate research on mouse Rprml include:

  1. CRISPR/Cas9 gene editing for precise manipulation of Rprml expression

  2. Proteomics approaches for comprehensive identification of interaction partners

  3. Single-cell RNA sequencing to characterize cell-specific expression patterns

  4. Advanced imaging techniques to visualize subcellular localization and dynamics

  5. High-throughput screening methods to identify modulators of Rprml function

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice packaging is preferred, please communicate with us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
Rprml; Reprimo-like protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-117
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Rprml
Target Protein Sequence
MNVSFLNHSGLEEVGGDARATLGNRSHGLGTWLDCCPGGAPLTASDGVPAGLAPDERSLW VSRVAQIAVLCVLSLTVVFGVFFLGCNLLIKSESMINFLMQERRPSKDVGAAILGLY
Uniprot No.

Target Background

Database Links

KEGG: mmu:104582

UniGene: Mm.44618

Protein Families
Reprimo family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Reprimo-like protein (Rprml) and how does it relate to the Reprimo gene family?

Rprml belongs to the Reprimo gene family, which comprises single-exon genes with poorly understood physiological functions. While Reprimo (RPRM) has been characterized as a p53-dependent tumor suppressor functioning at the G2/M cell cycle checkpoint, Rprml has not yet had a firmly established role in physiology or pathology. The gene family's expression pattern shows conservation between zebrafish and human species, suggesting evolutionary importance . Unlike many genes, Rprml is intronless and expressed at very low levels in most tissues according to the Genotype-Tissue Expression (GTEx) database .

What are the known biological functions of Rprml in development?

Research using zebrafish models has revealed that Rprml plays an essential role in hematovascular development during embryonic stages. While the formation of hemangioblasts and the primitive wave of hematopoiesis occur normally in the absence of rprml, the loss of rprml leads to impaired definitive hematopoiesis. Specifically, there is a significant reduction in erythroid-myeloid precursors (EMP) at the posterior blood island (PBI) and a decline in definitive hematopoietic stem/progenitor cells (HSPCs) . Additionally, loss of rprml increases caspase-3 activity in endothelial cells within the caudal hematopoietic tissue (CHT), which serves as the first perivascular niche where HSPCs reside during zebrafish embryonic development .

What experimental approaches are most effective for studying Rprml function in mouse models?

When studying Rprml in mouse models, researchers should consider both genetic manipulation techniques and careful experimental design principles. For genetic manipulation, CRISPR-Cas9 has been effectively used to disrupt rprml expression in animal models . Antisense morpholino oligonucleotides have also proven useful for knockdown studies .

For experimental design, researchers should follow established principles that promote reproducibility. The National Centre for the Replacement, Refinement and Reduction of Animals in Research (NC3Rs) guidelines provide a framework for ethical and reproducible animal research . Careful selection from available mouse strains is crucial, as phenotypic variability can occur despite genetic identity within a strain. Additionally, researchers must consider that mice are biological entities sensitive to environmental factors and continue to change developmentally over time .

What are the challenges in detecting and measuring Rprml expression in tissue samples?

Detecting Rprml presents significant challenges due to its naturally low expression levels in most tissues. For protein detection, immunohistochemical (IHC) staining has been successfully employed, though results typically show weak to moderate cytoplasmic expression even in normal tissues . When analyzing Rprml expression, researchers should employ semi-quantitative scoring systems. For example, in gastric tissue studies, median RPRML IHC scores were 1.5 (interquartile range: 1.0–1.5) in non-tumor adjacent mucosa compared to 0.5 (IQR: 0.1–1.0) in tumor tissues .

For transcript detection, techniques sensitive to low expression levels such as quantitative RT-PCR following treatment with demethylating agents may be necessary to overcome epigenetic silencing . RNA-seq data analysis requires careful normalization and comparison, as demonstrated in analyses of The Cancer Genome Atlas datasets that confirmed downregulation of RPRML mRNA in gastric tumor tissues .

How can recombinant Rprml be effectively produced for functional studies?

While the search results don't specifically detail production methods for recombinant Rprml, standard approaches for single-exon genes would apply. Since Rprml lacks introns, direct amplification from genomic DNA or cDNA can be performed for cloning into expression vectors. For functional studies, successful approaches have included stable transfection of GFP-tagged RPRML in cell lines that lack endogenous expression . Expression can be confirmed through fluorescence microscopy and Western blotting, with subsequent functional assays including colony formation, soft agar, MTS, and Ki67 immunofluorescence assays .

What evidence supports the tumor suppressor role of Rprml?

Multiple lines of experimental evidence support Rprml's tumor suppressor function. In vitro studies have demonstrated that RPRML overexpression significantly reduces clonogenic capacity, anchorage-independent growth, and cell proliferation . Specifically, cells with ectopic RPRML expression show decreased proliferation at 24h, 48h, and 72h after seeding as measured by MTS assay, and reduced expression of the proliferation marker Ki67 compared to both wild type and control GFP-expressing cells .

How does Rprml expression correlate with clinical outcomes in cancer models?

In gastric cancer studies, RPRML expression levels correlate significantly with patient outcomes, particularly in advanced disease stages. The following table summarizes key findings regarding RPRML expression and clinical outcomes:

SubgroupHazard Ratio (95% CI)p-Value
Stage I–II3.26 (0.30–35.84)0.334
Stage III–IV0.07 (0.01–0.46)0.005

When patients with advanced gastric cancer (Stage III-IV) were stratified into high and low RPRML expression groups, dramatic differences in survival rates were observed. The 2-year survival rates were 40.0% vs. 81.3%, and 5-year survival rates were 17.0% vs. 53.5% for low-expression vs. high-expression groups, respectively . This indicates that RPRML expression has prognostic value, particularly in advanced disease stages.

What is the potential of Rprml methylation as a biomarker in disease detection?

Circulating methylated RPRML DNA has demonstrated potential as a non-invasive biomarker for detecting diseases such as gastric cancer. Using a MethyLight assay covering 10 CpGs from a 142-bp target region near the transcription start site, studies have quantified methylated RPRML DNA in plasma samples . ROC curve analysis yielded an area under the curve (AUC) of 0.726 (95% CI: 0.583–0.869, p = 0.006) .

At an optimal cut-off point of 1.0 copy/mL plasma, the detection sensitivity for gastric cancer was 56.0% (95% CI: 34.93–75.60) with a specificity of 88.0% (95% CI: 68.78–97.45). The positive likelihood ratio was 4.67 (95% CI: 1.53–14.26) and the odds ratio was 9.34 (95% CI: 2.20–39.46, p = 0.002) . These metrics suggest that while methylated RPRML DNA alone may not achieve sufficient sensitivity for screening purposes, it could contribute to multi-biomarker panels without adding significant false positives.

How can researchers address phenotypic variability in mouse models when studying Rprml?

When working with mouse models to study Rprml, researchers must account for phenotypic variability even within genetically identical strains. This variability can confound experimental results if not properly addressed. Key strategies include:

  • Statistical power calculations to determine appropriate sample sizes that account for expected variability

  • Randomization of animals to experimental groups

  • Blinding of researchers during data collection and analysis

  • Careful control of environmental factors that might influence phenotype

  • Inclusion of appropriate control groups matched for age, sex, and housing conditions

Additionally, researchers should report all relevant experimental conditions, including housing, diet, and handling procedures, to enhance reproducibility across different laboratories .

What are the recommended methods for detecting Rprml protein localization in tissue samples?

For detecting Rprml protein localization in tissue samples, immunohistochemistry (IHC) has been successfully employed. In gastric tissues, RPRML protein shows weak to moderate cytoplasmic expression in glandular and foveolar epithelial cells of normal mucosa . For quantification, semi-quantitative scoring systems have been used, with scores typically ranging from 0 to 3.

For more precise localization studies, immunofluorescence techniques can be used, as demonstrated with Ki67 and RPRML co-staining in proliferation studies . When working with recombinant tagged versions of the protein (such as GFP-tagged RPRML), fluorescence microscopy provides direct visualization of protein localization . Western blotting serves as a complementary approach to confirm expression levels and protein size.

How can researchers distinguish between the effects of Rprml and other Reprimo family members?

Distinguishing between Rprml and other Reprimo family members requires careful experimental design and specific analytical approaches:

  • Use gene-specific targeting with CRISPR-Cas9 or antisense morpholino oligonucleotides that are designed to minimize off-target effects on related family members

  • Employ rescue experiments with specific recombinant proteins to confirm phenotypic effects

  • Utilize specific antibodies validated for selectivity against other family members

  • Design RT-PCR primers that target unique regions of each family member's sequence

  • Perform comparative expression analyses across tissues and developmental stages to identify differential expression patterns

While Reprimo (RPRM) and Reprimo-like (RPRML) share functional similarities as tumor suppressors, their tissue-specific expression patterns and regulation may differ, providing additional means of discrimination .

How should researchers interpret conflicting data regarding Rprml expression patterns across different tissues?

When encountering conflicting data about Rprml expression patterns, researchers should consider several factors:

  • Tissue-specific regulation mechanisms, as Rprml is expressed at varying levels across different tissues

  • Developmental timing, as expression may change throughout embryonic and adult stages

  • Epigenetic regulation through DNA methylation, which can vary by tissue type and physiological state

  • Sensitivity limitations of different detection methods, particularly given Rprml's naturally low expression levels

  • Species differences, though expression patterns show conservation between some species like zebrafish and humans

Researchers should validate findings using multiple detection methods (e.g., both RNA and protein detection) and consider using 5-azacytidine treatment to unmask expression that may be silenced by methylation .

What considerations are important when analyzing the impact of Rprml knockout or overexpression?

When analyzing the impact of Rprml manipulation, researchers should consider:

  • The model system context – effects may differ between in vitro cell lines, zebrafish models, and mouse models

  • Compensatory mechanisms – other Reprimo family members may partially compensate for Rprml loss

  • Developmental timing – effects of manipulation may vary based on when Rprml function is altered

  • Tissue specificity – impacts may be more pronounced in tissues where Rprml normally plays a crucial role

  • Assessment of multiple endpoints – examine both molecular (e.g., cell cycle) and phenotypic (e.g., hematopoiesis) outcomes

For knockout studies, both complete gene knockout and conditional approaches should be considered, as the former may reveal developmental roles while the latter can help distinguish between developmental and homeostatic functions in adult tissues.

How can researchers effectively compare Rprml functions across different species models?

Cross-species comparison of Rprml functions requires careful consideration of evolutionary conservation and divergence:

  • Sequence homology analysis to determine conservation of key functional domains

  • Expression pattern comparison across equivalent developmental stages and tissues

  • Functional testing in multiple species using comparable methodologies

  • Creation of humanized mouse models expressing human RPRML when appropriate

  • Complementation studies to determine functional equivalence across species

The conservation of RPRML expression patterns between zebrafish and humans suggests functional conservation , but researchers should still validate findings across species. When studying disease relevance, consider species-specific differences in disease susceptibility and progression that might influence the interpretation of Rprml's role.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.