Recombinant Mouse Reticulon-1 (Rtn1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Rtn1; Nsp; Reticulon-1; Neuroendocrine-specific protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-780
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MAAPPDLQDEPLSLGSPGSQWFGGRGDGEDEATAVMGARPAQQDGEPAWGSGAGAGVTSS RELCSGPARSPPVAMETASTGMAAVPDALDHSPSSTLKDGEGACYTSLISDVCYPPREDS AYFTGILQKENGHITTSESPEEPETPGPSLPEVPGMEPQGLLSSDSGIEMTPAESTEVNK ILADPLDQMKAEAYKYIDITRPQEAKGQEEQHPGLEDKDLDFKDKDTEVSTKAEGVRAPN QPAPVEGKLIKDHLFEESTFAPYIDELSDEQHRVSLVTAPVKITLTEIEPPLMTATQETI PEKQDLCLKPSPDTVPTVTVSEPEDDSPGSVTPPSSGTEPSAAESQGKGSVSEDELIAAI KEAKGLSYETTESPRPVGQVADKPKTKTRSGLPTIPSPLDQEASSAESGDSEIELVSEDP MASEDALPSGYVSFGHVSGPPPSPASPSIQYSILREEREAELDSELIIESCDASSASEES PKREQDSPPMKPGALDAIREETGSRATEERAPSHQGPVEPDPMLSFAPAAALQSRPEPSS GDGASVPEPPRSQQQKPEEEAVSSSQSPTATEIPGPLGSGLMPPLPFFNKQKAIDLLYWR DIKQTGIVFGSFLLLLFSLTQFSVVSVVAYLALAALSATISFRIYKSVLQAVQKTDEGHP FKAYLELEITLSQEQIQKYTDCLQLYVNSTLKELRRLFLVQDLVDSLKFAVLMWLLTYVG ALFNGLTLLLMAVVSMFTLPVVYVKHQAQVDQYLGLVRTHINTVVAKIQAKIPGAKRHAE
Uniprot No.

Target Background

Function
Inhibits amyloid precursor protein processing, likely by blocking BACE1 activity.
Gene References Into Functions

Functional Studies of Reticulon-1 (RTN1A):

  1. Endoplasmic reticulum (ER) stress is implicated in podocyte injury in diabetic nephropathy, with RTN1A potentially serving as a key ER stress regulator in podocytes. PMID: 28336924
  2. Reticulon-1 influences macrophage chemotaxis, exhibiting reduced activity in macrophages derived from bone marrow of ultraviolet-irradiated and ultraviolet-chimeric mice. PMID: 29167231
  3. RTN1A acts as a key mediator in proteinuria-induced tubular cell toxicity and renal fibrosis. PMID: 26739891
  4. RTN1A contributes to kidney disease progression by inducing ER stress. PMID: 26227493
  5. RTN-1C regulates gene expression, modulating transcript clusters associated with neurodegenerative disorders. PMID: 20708685
Database Links
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is Reticulon-1 (Rtn1) and where is it primarily expressed?

Reticulon-1 (Rtn1) is a member of the reticulon family of proteins that primarily localizes to the endoplasmic reticulum and plays crucial roles in shaping tubular ER structure. It contains a conserved carboxy-terminal reticulon homology domain (RHD) that facilitates its association with membranes and a variable amino-terminal region that likely mediates its specific functions. The expression pattern of Rtn1 varies across different tissues and cell types, consistent with the evolution of cell-type-specific roles for reticulons . This diversity in expression patterns suggests specialized functions in different cellular contexts, which researchers should consider when designing experiments. Unlike RTN4 (Nogo-A), which has been extensively studied for its role in inhibiting axon regeneration after injury, the specific expression pattern of Rtn1 across different tissues has not been as thoroughly characterized .

What structural characteristics define Reticulon-1?

Reticulon-1, like other reticulon family members, is characterized by a highly conserved carboxy-terminal reticulon homology domain (RHD), which facilitates its association with the endoplasmic reticulum membrane. In contrast to this conserved region, the amino-terminal domains of reticulons display no sequence similarity, even among paralogs within the same species . This structural organization suggests that while the RHD mediates common functions shared across the reticulon family, the diverse amino-terminal domains contribute to specialized functions of each variant. The amino-terminal regions of reticulons, including Rtn1, appear to be highly unstructured even under physiological conditions . This inherent flexibility may enable interactions with various protein partners and facilitate multiple conformations, allowing reticulons to perform diverse cellular functions. The membrane topology of reticulons can be complex, with evidence suggesting they may adopt different conformations in different cellular contexts .

How does Rtn1 interact with other cellular proteins?

Reticulon-1 engages in multiple protein interactions that reflect its diverse cellular functions. The mammalian RTN1 isoforms RTN1A and RTN1B have been found to interact with components of the endocytosis adaptor complex AP-2 through yeast two-hybrid screening . In contrast, RTN1C appears to be involved in exocytosis, as it co-immunoprecipitates with SNARE proteins including syntaxin 1, syntaxin 7, syntaxin 13, and VAMP2 . This association with multiple SNARE proteins suggests a role in vesicular fusion events. Additionally, RTN1, along with other reticulons, was identified in a yeast two-hybrid screen using the vesicle fusion protein chaperone β-SNAP as bait, although these interactions were not confirmed by co-immunoprecipitation . In the context of apoptosis regulation, RTN1C was found to inhibit Bcl-XL, a powerful inhibitor of apoptosis, demonstrating a pro-apoptotic role for this reticulon isoform . These diverse interactions highlight Rtn1's involvement in multiple cellular processes, including vesicular trafficking and apoptosis regulation.

What is known about the role of Rtn1 in neuronal development?

Recent research has revealed critical roles for Rtn1 in neuronal development, particularly when studied in conjunction with Rtn3. In R1R3dKO mice, significantly impaired axonal growth was observed in a region-specific manner, as detected by immunohistochemical staining with antibodies to neurofilament light chain and neurofilament medium chain . Ultrastructural examination by electron microscopy revealed a significant reduction in synaptic active zone length in the hippocampus of these mice . These findings suggest that Rtn1 and Rtn3 work together to orchestrate neurofilament organization and maintain intact synaptic structures in the central nervous system. Mechanistic exploration through unbiased proteomic assays identified reduction of proteins such as FMR1, Staufen2, Cyfip1, Cullin-4B, and PDE2a in R1R3dKO mice - all known components in the fragile X mental retardation pathway . This suggests that Rtn1 might influence neurodevelopment through pathways associated with synaptic plasticity and neuronal maturation, potentially linking reticulon function to neurodevelopmental disorders.

What are the optimal expression systems and purification strategies for recombinant mouse Rtn1?

Producing recombinant mouse Rtn1 requires careful consideration of expression systems and purification strategies due to its membrane-associated nature. Based on methodologies used for similar proteins, an E. coli expression system using vectors such as pET-28a with appropriate restriction enzyme sites (such as BamHI and EcoRI) can be effective . For PCR amplification of the Rtn1 gene, initial denaturation at 95°C for 30 seconds followed by 30 cycles of denaturation (94°C, 30 seconds), annealing (typically 52-55°C, 30 seconds), and extension (72°C, 90 seconds) can yield good results . Adding affinity tags such as His-tags facilitates subsequent purification using metal affinity chromatography. After initial purification, size exclusion chromatography is recommended to enhance purity. The purified protein should be verified by Western blot using antibodies against either Rtn1 or the affinity tag . A critical consideration is protein folding, as membrane proteins often require detergents to maintain their native conformation. To assess immunogenicity and functionality of the purified protein, pilot immunization studies with adjuvants such as Freund's complete adjuvant can be conducted, followed by antibody titer analysis and functional assays .

How can researchers investigate the membrane topology of Rtn1?

Investigating the membrane topology of Rtn1 presents significant challenges due to its complex association with the ER membrane. Evidence suggests that reticulons might adopt different topologies in different cellular contexts . A comprehensive approach would combine multiple experimental techniques. Cysteine accessibility studies, where membrane-impermeable reagents like maleimide polyethylene glycol are used to probe the accessibility of cysteine residues, can reveal which domains are exposed to the cytoplasm versus the ER lumen. Similar approaches with RTN4 have shown that cysteines in the amino-terminal domain and loop regions were modified by such reagents only after membrane disruption, suggesting cytoplasmic localization . Protease protection assays, where susceptibility to proteolytic cleavage indicates cytoplasmic exposure, provide complementary data. Fluorescence-based approaches using protein fusions or domain-specific antibodies can provide spatial information when combined with selective membrane permeabilization. For detailed structural analysis, cryo-electron microscopy of purified Rtn1 in lipid nanodiscs could reveal its precise membrane integration. Researchers should note that different reticulon isoforms might have different topologies, and these may vary between plasma membrane and ER localizations .

How can functional redundancy between Rtn1 and other reticulons be systematically investigated?

The observation that Rtn1 knockout mice show no discernible phenotypes while Rtn1/Rtn3 double knockout mice exhibit neonatal lethality highlights significant functional redundancy among reticulons . To systematically investigate this redundancy, researchers should implement a multi-faceted approach. First, generating a complete series of single, double, and where viable, triple knockout models of reticulon family members allows for comprehensive phenotypic comparison. Rescue experiments where individual reticulons are reintroduced into multiple-knockout backgrounds can identify which functions can be restored by which family members. Domain-swapping experiments, exchanging the conserved RHD and variable amino-terminal regions between different reticulons, can determine which domains mediate shared versus specific functions. Comparative transcriptomic and proteomic analyses across different tissues in various knockout models can reveal compensatory changes in expression patterns. Time-course studies during development are particularly important, as the R1R3dKO phenotype suggests critical developmental roles . Tissue-specific conditional knockouts can help address the challenge of neonatal lethality while exploring region-specific functions in the adult nervous system. When designing these studies, researchers should consider that redundancy may vary across different cell types and developmental stages.

What methodological approaches can elucidate Rtn1's role in ER morphogenesis?

Investigating Rtn1's role in ER morphogenesis requires specialized techniques due to the complex and dynamic nature of the ER. Super-resolution microscopy techniques such as STORM, PALM, or lattice light-sheet microscopy can visualize ER tubule formation and structure at nanometer resolution. Live-cell imaging with fluorescently tagged Rtn1 allows tracking of dynamic changes in ER morphology. Correlative light and electron microscopy (CLEM) combines the benefits of fluorescence localization with ultrastructural details. For functional studies, acute depletion using techniques like auxin-inducible degradation provides temporal control over Rtn1 removal, allowing observation of immediate effects on ER structure. In vitro reconstitution assays using purified Rtn1 and artificial membrane systems can test its intrinsic ability to induce membrane curvature. Sophisticated image analysis algorithms should be developed to quantify parameters such as ER tubule diameter, branching complexity, and network dynamics from microscopy data. When interpreting results, researchers should consider that reticulons work in concert with other ER-shaping proteins like atlastins and REEP proteins. Combined manipulation of multiple ER-shaping protein families may be necessary to fully understand Rtn1's specific contribution to ER morphogenesis .

How can proteomics be used to identify Rtn1-dependent molecular pathways?

Proteomic approaches offer powerful tools to decipher Rtn1-dependent molecular pathways, as demonstrated by the identification of reduced proteins in the fragile X mental retardation pathway in R1R3dKO mice . For comprehensive analysis, researchers should employ multiple complementary proteomic strategies. Comparative proteomics between wild-type and Rtn1 knockout or Rtn1/Rtn3 double knockout tissues can reveal differentially expressed proteins across various cellular compartments. For direct interactors, immunoprecipitation followed by mass spectrometry (IP-MS) using antibodies against native Rtn1 or epitope-tagged recombinant versions can identify protein binding partners. Proximity labeling approaches like BioID or APEX, where a biotin ligase or peroxidase is fused to Rtn1, can capture even transient or weak interactions within the native cellular environment. Subcellular fractionation prior to proteomic analysis allows focused examination of ER-associated changes. When analyzing membrane proteins, specialized extraction methods using appropriate detergents are essential to capture hydrophobic proteins that might otherwise be underrepresented. To overcome the challenge of functional redundancy, comparative proteomic analysis across multiple reticulon knockouts can distinguish Rtn1-specific pathways from those generally regulated by the reticulon family. Bioinformatic analysis integrating proteomics data with transcriptomics and interactome databases can place identified proteins within functional networks and biological pathways .

What experimental approaches can identify tissue-specific roles of Rtn1 isoforms?

Investigating tissue-specific roles of Rtn1 isoforms requires strategies that address both expression patterns and functional consequences in different cellular contexts. RNA sequencing across diverse tissues can map the expression profiles of specific Rtn1 isoforms, while isoform-specific antibodies enable protein-level verification through immunohistochemistry and Western blotting. Single-cell RNA sequencing offers even finer resolution, revealing cell type-specific expression patterns within complex tissues. For functional studies, CRISPR-Cas9 gene editing can be used to selectively modify or delete specific Rtn1 isoforms while leaving others intact. Tissue-specific or inducible promoters driving Cre recombinase expression can be combined with floxed Rtn1 alleles for conditional knockout in specific tissues or developmental stages. For overexpression studies, viral vectors with tissue-specific promoters allow targeted expression of individual Rtn1 isoforms. Ex vivo tissue cultures or organoids derived from different tissues can be manipulated to assess isoform-specific functions in physiologically relevant contexts. When interpreting results, researchers should consider that different Rtn1 isoforms may have distinct interactomes, subcellular localizations, or post-translational modifications in different tissues, potentially explaining tissue-specific functions despite shared primary sequences .

How can researchers analyze the role of Rtn1 in axonal growth and synapse formation?

Analyzing Rtn1's role in axonal growth and synapse formation requires specialized neurobiology techniques informed by the phenotypes observed in R1R3dKO mice . Primary neuronal cultures from wild-type and knockout models allow detailed analysis of neurite outgrowth, branching patterns, and growth cone dynamics. For spatiotemporal control, optogenetic or chemogenetic approaches can manipulate Rtn1 function in specific neuronal compartments at defined time points. High-resolution time-lapse imaging combined with fluorescent cytoskeletal markers can reveal how Rtn1 influences growth cone dynamics and axon extension. For synapse analysis, array tomography or expansion microscopy with pre- and post-synaptic markers provides detailed information on synapse number, size, and molecular composition. Electron microscopy is essential for ultrastructural analysis of synaptic features such as active zone length, as demonstrated in R1R3dKO mice . Electrophysiological recordings can assess functional consequences on synaptic transmission. For in vivo approaches, in utero electroporation or viral-mediated gene delivery can manipulate Rtn1 expression in developing neurons, followed by histological and functional analysis. When designing these studies, researchers should consider region-specific effects, as impaired axonal growth in R1R3dKO mice was observed in a region-specific manner . Additionally, examining interactions between Rtn1 and cytoskeletal components or guidance cue receptors can provide mechanistic insights into how Rtn1 influences neuronal morphogenesis.

What methodologies can investigate Rtn1's potential role in neurodegenerative diseases?

Investigating Rtn1's potential role in neurodegenerative diseases requires approaches that connect its cellular functions to disease mechanisms. Analysis of human post-mortem brain tissue can reveal alterations in Rtn1 expression, localization, or post-translational modifications across different neurodegenerative conditions. Animal models of neurodegenerative diseases can be crossed with Rtn1 transgenic or knockout lines to determine if Rtn1 modulation affects disease progression. Cell culture models using patient-derived neurons (through iPSC technology) allow for detailed cellular phenotyping in human genetic backgrounds. Since reticulons have been implicated in apoptosis, with RTN1C shown to inhibit the anti-apoptotic protein Bcl-XL , researchers should examine how Rtn1 manipulation affects neuronal survival under various stress conditions relevant to neurodegeneration. The connection to ER function suggests examining unfolded protein response (UPR) markers after Rtn1 manipulation, as ER stress is implicated in many neurodegenerative conditions. The finding that RTN4A (Nogo-A) inhibits neurite outgrowth and axon regeneration warrants investigation into whether Rtn1 similarly affects neuronal plasticity and regeneration after injury. Proteomic analysis comparing Rtn1-dependent changes with known disease-associated pathways, as performed with the fragile X mental retardation pathway in R1R3dKO mice , may reveal unexpected connections to disease mechanisms.

How can the effects of post-translational modifications on Rtn1 function be determined?

Investigating post-translational modifications (PTMs) of Rtn1 requires specialized techniques to identify modification sites and their functional consequences. Mass spectrometry-based PTM mapping using enrichment strategies for phosphorylation, glycosylation, ubiquitination, or other modifications can identify specific sites on Rtn1. Site-directed mutagenesis of identified PTM sites followed by functional assays can determine each modification's biological significance. For phosphorylation studies, phospho-specific antibodies or phosphatase treatments allow manipulation and detection of Rtn1's phosphorylation state. Kinase inhibitor screens can identify enzymes responsible for Rtn1 phosphorylation. For studying dynamic regulation, pulse-chase experiments with metabolic labeling can track PTM turnover rates. Structural studies comparing modified and unmodified Rtn1 can reveal how PTMs affect protein conformation. Comparative PTM analysis across different cell types, developmental stages, or disease states can provide insights into context-specific regulation. When designing these studies, researchers should consider that different Rtn1 isoforms may undergo distinct patterns of modification. Additionally, since Rtn1's membrane topology may be complex with multiple conformations , certain PTM sites might be accessible to modifying enzymes only in specific conformational states, potentially creating a feedback loop between conformation and modification.

How can researchers differentiate between direct and indirect effects of Rtn1 manipulation?

Differentiating between direct and indirect effects of Rtn1 manipulation represents a significant challenge in experimental design. Acute versus chronic manipulation strategies can help distinguish immediate effects (likely direct) from adaptive responses (often indirect). Rescue experiments with full-length Rtn1 versus domain-specific constructs can identify which regions mediate specific phenotypes. In vitro reconstitution with purified components allows testing of direct biochemical activities without cellular complexity. Comparing the timing of different phenotypic changes after Rtn1 manipulation can establish causality chains. For protein interaction studies, techniques like Förster resonance energy transfer (FRET) or bimolecular fluorescence complementation (BiFC) can confirm direct physical interactions in living cells. When analyzing knockout phenotypes, researchers must consider compensatory changes in other reticulons, particularly given the observed redundancy between Rtn1 and Rtn3 . Tissue-specific or cell-type-specific Rtn1 manipulation can help distinguish autonomous versus non-autonomous effects. Single-cell analysis techniques can reveal the heterogeneity of responses to Rtn1 manipulation within populations. For developmental studies, temporally controlled manipulations at different stages can determine critical periods for Rtn1 function, as demonstrated by the developmental defects in R1R3dKO mice . When designing experiments, researchers should consider that many Rtn1 effects may be mediated through its role in ER morphogenesis, which could have numerous downstream consequences.

Comparison of Reticulon Family Members in Mice

ReticulonPrimary LocalizationKey FunctionsKnockout Phenotype
RTN1Endoplasmic reticulumER morphogenesis, vesicular traffickingNo discernible phenotype when knocked out alone
RTN3Endoplasmic reticulumER morphogenesis, vesicular traffickingNo discernible phenotype when knocked out alone
RTN1+RTN3Endoplasmic reticulumNeurofilament organization, synaptic structureNeonatal lethality, impaired neuromuscular junction, axonal growth defects
RTN4 (Nogo)ER, plasma membraneInhibition of neurite outgrowth, axon regenerationVariable depending on isoform and region targeted

Protein Interactions of Reticulon-1

Interacting ProteinDetection MethodFunctional Implication
AP-2 complexYeast two-hybridInvolvement in endocytosis
Syntaxin 1Co-immunoprecipitationRole in exocytosis
Syntaxin 7Co-immunoprecipitationRole in exocytosis
Syntaxin 13Co-immunoprecipitationRole in exocytosis
VAMP2Co-immunoprecipitationRole in exocytosis
β-SNAPYeast two-hybridVesicle fusion processes
Bcl-XLProtein interaction studiesPro-apoptotic function

Proteins Reduced in Rtn1/Rtn3 Double Knockout Mice

ProteinFunctionPathway Association
FMR1RNA binding proteinFragile X mental retardation pathway
Staufen2RNA transportFragile X mental retardation pathway
Cyfip1Cytoskeletal regulationFragile X mental retardation pathway
Cullin-4BUbiquitin ligase complexFragile X mental retardation pathway
PDE2aPhosphodiesteraseFragile X mental retardation pathway

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.