Recombinant Mouse Reticulon-2 (Rtn2)

Shipped with Ice Packs
In Stock
Cat. No.
BT2501620
Source
in vitro E.coli expression system
Synonyms
Rtn2; Nspl1; Reticulon-2; Neuroendocrine-specific protein-like 1; NSP-like protein 1; Neuroendocrine-specific protein-like I; NSP-like protein I; NSPLI
Quick Inquiry

Description

Introduction to Recombinant Mouse Reticulon-2 (Rtn2)

Recombinant Mouse Reticulon-2 (Rtn2) is a protein produced through recombinant DNA technology, where the gene encoding Reticulon-2 is inserted into a host organism such as yeast, E. coli, or mammalian cells to express the protein. Reticulon-2 is part of the reticulon family, which is associated with the endoplasmic reticulum (ER) and plays roles in neuroendocrine secretion and membrane trafficking . This article will delve into the characteristics, production methods, and potential applications of Recombinant Mouse Reticulon-2.

Production Methods

Recombinant Mouse Reticulon-2 can be produced using various expression systems:

Expression SystemDescription
YeastOffers a eukaryotic environment for protein folding and post-translational modifications, which can be crucial for maintaining protein function .
E. coliA common bacterial system for high-yield protein production. It is cost-effective but may require additional steps for protein folding and modification .
Mammalian CellsProvides a more native environment for protein expression, ensuring proper folding and modifications, which is beneficial for proteins requiring complex processing .
BaculovirusUtilizes insect cells for expression, offering a balance between yield and proper protein processing .

Research Findings and Applications

While specific research on Recombinant Mouse Reticulon-2 is limited, studies on Reticulon-2 itself provide valuable insights into its potential applications:

  • Neurological Disorders: Mutations in the RTN2 gene have been linked to hereditary spastic paraplegia, a neurodegenerative condition affecting the corticospinal tract . Understanding the role of Reticulon-2 in ER shaping and axonopathy could lead to therapeutic strategies.

  • Cancer Research: Reticulon-2 has been implicated in promoting metastasis in gastric and ovarian cancers, suggesting its potential as a biomarker or therapeutic target .

  • Viral Replication: Reticulon proteins are involved in the replication of positive-strand RNA viruses, making them interesting for antiviral research .

Data and Tables

Table 1: Expression Systems for Recombinant Mouse Reticulon-2

Expression SystemSource OrganismAdvantages
YeastSaccharomyces cerevisiaeEukaryotic environment for proper folding
E. coliEscherichia coliHigh yield, cost-effective
Mammalian CellsVarious cell linesNative environment for complex modifications
BaculovirusInsect cellsBalanced yield and processing

Table 2: Potential Applications of Reticulon-2

Application AreaDescription
Neurological DisordersStudy of hereditary spastic paraplegia
Cancer ResearchBiomarker or therapeutic target for gastric and ovarian cancers
Viral ReplicationInvolvement in positive-strand RNA virus replication

References GeneCards. RTN2 Gene - Reticulon 2. Nature. Reticulon 2 promotes gastric cancer metastasis via activating... PubMed. Mutations in the ER-shaping protein reticulon 2 cause the... Wikipedia. RTN2 Spandidos Publications. RTN2, a new member of circadian clock genes identified by... Cusabio. Recombinant Mouse Reticulon-2 (Rtn2), partial.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Rtn2; Nspl1; Reticulon-2; Neuroendocrine-specific protein-like 1; NSP-like protein 1; Neuroendocrine-specific protein-like I; NSP-like protein I; NSPLI
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-471
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Rtn2
Target Protein Sequence
MGQVLPVFAHCKEAPSTASSTPDSTEGGNDDSDFRELHTAREFSEDEEEETTSQDWGTPR ELTFSYIAFDGVVGSGGRRDSVVRRPRPQGRSVSEPRDPPQQSGLGDSLESIPSLSQSPE PGRRGDPDPVPPAERPLEELRLRLDQLGWVVRSAGSGEDSATSSSTPLENEEPDGLEASE AGEETNLELRLAQSLHLQLEVLTPQLSPSSGTPQAHTPSPQRSQDSNSGPDDEPLLNVVE EHWRLLEQEPITAQCLDSTDQSEFMLEPLLLVADLLYWKDTRTSGAVFTGLMASLLCLLH FSIVSVAAHLALLGLCATISLRVYRKVLQAVHRGDGTNPFQAYLDMDLTLTREQTERLSQ QIASHVVSTATQLRHFFLVEDLVDSLKLALLFYILTFVGAIFNGLTLVILGVVALFTVPL LYRQHQAQIDQYVGLVTNQLSHIKAKIRAKIPGTGTLAPTASVSGSKAKAE
Uniprot No.
O70622

Target Background

Function

Recombinant Mouse Reticulon-2 (Rtn2) inhibits amyloid precursor protein processing, likely by blocking BACE1 activity. It enhances trafficking of the glutamate transporter SLC1A1/EAAC1 from the endoplasmic reticulum to the cell surface. Furthermore, Rtn2 plays a role in the translocation of SLC2A4/GLUT4 from intracellular membranes to the cell membrane, facilitating glucose uptake.

Database Links

KEGG: mmu:20167

STRING: 10090.ENSMUSP00000032559

UniGene: Mm.24142

Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Sarcoplasmic reticulum membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Cell membrane, sarcolemma; Multi-pass membrane protein. Cell membrane, sarcolemma, T-tubule; Multi-pass membrane protein. Cytoplasm, myofibril, sarcomere, Z line. Cytoplasm, cytoskeleton.
Tissue Specificity
Detected in skeletal and cardiac muscle (at protein level). Expressed predominantly in neural and muscular tissues.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Category

Service

THE BIOTEK
THE BioTek is a global biotech company offering highly purified proteins for research in cancer, apoptosis, development, endocrinology, immunology, neuroscience, proteases, and stem cells.
  • Contact
  • Address: 1925 E Maple Ave, El Segundo, CA 90245 United States
  • Phone : +1 201-285-7826
  • Email : info@thebiotek.com
  • Hours : Mon.-Fri. 9:00 AM - 5:00 PM
© Copyright 2025 TheBiotek. All Rights Reserved.